Istituto Italiano della Saldatura – Lungobisagno Istria, 15 – 16141 Genova (I) - Tariffa regime libero: “Poste Italiane SpA - Sped. A.P. 70%, DCB Genova” Tassa Pagata - Taxe Perçue ordinario - Contiene IP + Supplemento - Bimestrale Settembre - Ottobre 2012 ISSN:0035-6794
Organo Ufficiale dell’Istituto Italiano della Saldatura - anno LXIV - N. 5 * 2012
Genova, 23-24 Maggio 2013
Porto Antico di Genova, Centro Congressi
Giornate Nazionali di Saldatura
Tecnologia Superiore
Commersald è da anni conosciuta
come produttrice di impianti
con tecnologia P.T.A.
per riporti saldati ed eccelle
nella progettazione ed assistenza
post-vendita in tutto il mondo
degli impianti realizzati.
Esperienza, innovazione e Àessibilitj
garantiscono un servizio vincente
per una tecnologia superiore.
PROGETTAZIONE SERVIZIO TECNICO FORNITURA MATERIALI ASSISTENZA POST VENDITA LOGISTICA
Commersald Impianti S.R.L.
via Labriola, 39
41123 Modena - Italy
Tel.: +39.059.822374
Fax: +39.059.333099
C
Comm
Co
omm
mmer
ersa
er
sald
sa
ld S.P.A.
S.P
P.A
.A.
A.
Commersald
via Bottego, 245
41126 Modena - Italy
Tel.: +39.059.348411
Fax: +39.059.343297
www.commersald.com
Filiale Commersald Group
via E. De Marchi, 4
20125 Milano - Italy
Tel.: +39.02.67382348
Fax: +39.02.66710308
Articoli
Alcuni metodi per la valutazione della suscettibilità al
fenomeno delle cricche da riscaldo (reheat cracking)
della zona fusa dell’ acciaio 2,25Cr 1Mo 1/4V: Gleeble
test®, GDMS, trazione a caldo (Mini JIP Project)
A. Bertoni e C. Chovet
595
Una testimonianza altamente qualificata, di sicuro interesse
per gli operatori del comparto petrolchimico, interessato
nel recente passato da fenomeni di reheat cracking in zona
fusa accaduti in sede di fabbricazione di reattori di elevato
spessore con acciaio tipo 2.25 Cr 1 Mo 0,25 V.
In particolare, Bertoni e Chovet illustrano le caratteristiche
del metodo meccanico per la valutazione della sensibilità
della zona fusa a questo fenomeno, che prevede l’esecuzione
di una prova di trazione a caldo tipo Gleeble® con bassa
velocità di deformazione, che si è dimostrata estremamente
sensibile ad alcuni dei parametri caratteristici della prova.
L’articolo illustra i risultati ottenuti con il progetto di ricerca
europeo Mini JIP, volto appunto a meglio approfondire e
possibilmente superare tali criticità esecutive.
Saldatura ibrida laser-MIG di giunti a T in lega di
titanio - R. Spina et al.
Il Politecnico di Bari ed il Consorzio CALEF, da tempo
attivamente impegnati nello sviluppo e nella ricerca delle
tecnologie di saldatura laser, ci illustrano i risultati di
attività sperimentali condotte sulla realizzazione di giunti a
T a piena penetrazione a partire da spessori di 3 mm, in abito
aeronautico, con processo laser ibrido MIG con leghe tipo
ASTM B265 Gr. 5 (6Al 4V). Il processo è già stato impiegato
con successo, nell’ambito di un’analoga attività, su giunti
testa a testa; nel caso di giunti a T, particolare attenzione
è stata posta nella valutazione della geometria del cordone
di saldatura e negli aspetti energetici del processo stesso,
che sintetizza le proprietà tipiche del MIG (caratterizzato
da maggiori apporti termici) e del laser (in grado di
contenere invece le dimensioni della ZTA e le sue alterazioni
caratteristiche).
Recenti sviluppi della RBI - Risk Based Inspection
dell’American Petroleum Institute: l’integrazione
con la tecnologia del Fitness For Service per il
calcolo della probabilità di rilascio - S. Pinca
607
619
L’approccio denominato Risk Based Inspection è ormai
ampiamente consolidato in ambito petrolchimico, contesto
nel quale risulta codificato dalle Practice API RP 580 e
581. L’Ente normatore statunitense, la cui autorevolezza
è testimoniata dalla diffusione mondiale degli standard
dallo stesso elaborati, sottopone i propri documenti ad un
aggiornamento pressoché continuo, allo scopo di aggiornali
allo stato dell’arte, cogliendo tra l’altro e rielaborando i
preziosi contributi provenienti dagli utilizzatori finali, che
tali documenti impiegano. Recentemente è stata proposta
una revisione delle probabilità di rilascio che integra le
procedure di calcolo sviluppate nell’ambito delle valutazioni
affidabilistiche del Fitness For Service - FFS:
l’Ing. Stefano Pinca, riferimento per IIS Service per le
attività di Risk Based Inspection, ci illustra le caratteristiche
fondamentali di questa proposta.
State of the art for flaw assessment of pipeline girth
welds - H. Pisarski
Nell’ambito della meccanica della frattura vi sono
attualmente diversi approcci per valutare l’accettabilità delle
imperfezioni di saldature circonferenziali di tubazioni: essi
si traducono nel tentativo di ridurre i criteri di accettabilità
basati sulla buona pratica - che spesso considerano la
sola lunghezza del difetto - e nel tentativo di fornire uno
strumento per valutare i difetti rilevati attraverso il controllo
ultrasonoro, che fornisce una caratterizzazione dimensionale
del difetto stesso.
Il potenziale vantaggio di tali procedure è la riduzione dei
costi dovuta alla minore incidenza delle riparazioni e delle
tempistiche ad esse correlate, senza pregiudicare l’integrità
dei giunti stessi. I metodi più diffusi sono quelli basati sugli
standard BS 7910 e API 1104; nel caso in cui la deformazione
superi il limite elastico del materiale sono introdotte e
confrontate procedure basate sull’analisi delle deformazioni.
Tali procedure sono comprese nella Raccomandazione
DNV RP F108, che tratta principalmente l’installazione di
condotte ed i più recenti metodi sviluppati da ExxonMobil
e PRCI CRES per tubazioni soggette a pressione interna e
carico assiale.
Radiografia Digitale: Caratterizzazione dei sistemi
CR per applicazioni industriali - S. Rusca
Non vi è dubbio che la cosiddetta radiografia digitale abbia
assunto nell’ambito dei controlli non distruttivi un ruolo di
crescente rilievo; rispetto al tradizionale ambito della radiografia industriale analogica, per la quale sono ben note agli
addetti ai lavori le procedure da impiegare per la caratterizzazione delle principali attrezzature, nel caso dei sistemi CR (Radiografia Computerizzata) la conoscenza risulta
indubbiamente meno diffusa. A tale riguardo, un supporto è
certamente dato dalle recenti norme EN ed ISO, che costituiscono un valido riferimento, non tanto per condurre eventuali confronti rispetto alla tecnologia convenzionale, quanto per approfondire e comprendere le effettive potenzialità
delle proprie apparecchiature, per trarne il massimo delle
prestazioni. L’articolo è firmato dall’Ing. Simone Rusca, che
riveste ormai da anni il ruolo di Responsabile delle attività
di Formazione di IIS nell’ambito dei controlli non distruttivi
ed ha maturato tra le più significative esperienze nell’ambito
dei sistemi per radiografia computerizzata (CR).
Qualificazione del processo di placcatura, normativa
applicabile - A. Pandolfo
Le attività di qualificazione delle procedure, nell’ambito della fabbricazione mediante saldatura, hanno una valenza ben
nota agli addetti ai lavori e risultano inevitabilmente legate
al contesto contrattuale cui afferiscono, quindi a ben precisi
ambiti normativi, con particolare riferimento a quelli rappresentati dalla Sezione IX del Codice ASME BPV e della
normativa europea EN ISO 15614-X. Durante la realizzazione di apparecchiature in pressione, la placcatura riveste a
sua volta un ruolo essenziale per il conferimento al prodotto
delle richieste caratteristiche finali, per le quali non si può
ovviamente fare riferimento ai soli controlli diretti. Antonio
Pandolfo, riferimento ormai storico per queste attività, in IIS
prima ed in IIS CERT oggi, ci illustra quali siano le specificità della qualificazione delle procedure nel caso appunto
della placcatura.
Dagli anni sessanta l’impegno di IIS e IIS CERT
nella qualificazione, certificazione e approvazione
del personale PND - G. Costa e S. Morra
Lo scenario nazionale ed internazionale relativo agli addetti
alle prove non distruttive appare molto cambiato dagli anni
novanta ad oggi, tanto per i diversi player che operano oggi
nei servizi di certificazione quanto per la continua evoluzione
dei riferimenti normativi impiegati per le attività di certificazione. L’IIS ha indubbiamente avuto un ruolo da protagonista in questa evoluzione, con le proprie proposte formative
prima, con i propri servizi di qualificazione e certificazione
poi, affiancati con le attività di approvazione richieste nel
contesto della Direttiva 97/23/CE.
L’Ing. Giulio Costa, che ha vissuto in prima persona alcune
delle principali tappe di questo percorso temporale, ce ne illustra i passaggi fondamentali, che porteranno nel 2013 alla
nascita delle terza Società in Sede al Gruppo.
627
641
651
663
International Institute of Welding (IIW)
Creep rupture properties and fracture type of
9Cr-1Mo-V-Nb/18Cr-8Ni steel dissimilar joints
M. Yamazaki et al.
671
Il contributo proveniente dall’International Institute of Welding
(IIW) è sempre uno degli spazi più apprezzati dai nostri lettori e
permette un confronto sempre efficace con le esperienze maturate
presso i più importanti Istituti ed Enti di ricerca a livello
internazionale. Questa volta, il National Institute for Material
Science di Tokyo ci illustra i risultati di attività sperimentali
condotte su giunti realizzati con processo TIG e ad attrito
tra acciai tipo 9Cr 1Mo VNb e 18Cr 8 Ni, per i quali è stata
condotta una caratterizzazione con prove di scorrimento viscoso
a caldo (creep) a varie temperature e con diversi livelli di
tensione. Nelle analisi condotte, emergono le differenti condizioni
di rottura delle provette rispetto al materiale tipo 9Cr 1Mo VNb
sia per quanto concerne la resistenza che la modalità di frattura,
qualora si considerino i risultati di prove di lunga durata.
IIS Didattica
Introduzione al processo di saldatura al plasma
La sezione Didattica, a cura della Divisione Formazione
dell’Istituto, descrive in questo numero le caratteristiche
fondamentali del processo di saldatura al plasma.
Ampiamente utilizzato nell’industria chimica, meccanica e
siderurgica, l’arco plasma può offrire elevate prestazioni in
molteplici applicazioni, grazie alle diverse modalità
di saldatura che nel testo vengono descritte.
5 2012
ANNO LXIV Settembre - Ottobre 2012
Periodico Bimestrale
DIRETTORE RESPONSABILE:
Dott. Ing. Mauro Scasso
REDATTORE CAPO:
Dott. Ing. Michele Murgia; [email protected]
REDAZIONE:
683
Isabella Gallo; [email protected]
Maura Rodella; [email protected]
PUBBLICITÀ:
Franco Ricciardi; [email protected]
Cinzia Presti; [email protected]
ABBONAMENTI:
Francesca Repetto; [email protected]
Rubriche
Editoriale
Il primato dell’aritmetica
Scienza e Tecnica
Idrogeno e metalli - M. De Marco
IIS News & Events
Giornate Nazionali di Saldatura 7: lavori in corso
Abbiamo provato per voi
Liquidi Penetranti “Elite Flaw-Findr” di NDT ITALIANA
593
693
697
701
Dalle Aziende Features
Nuovo procedimento ICETM - Integrated Cold Electrode
di ESAB
711
Dalle Aziende
Comunicati Stampa
719
723
Notiziario
Letteratura Tecnica, Codici e Norme,
Corsi, Mostre e Convegni
Ricerche Bibliografiche da IIS-Data
Saldatura al plasma
Elenco degli Inserzionisti
In copertina
GNS7 - Genova
733
738
23-24 Maggio 2013,
Porto Antico di Genova,
Centro Congressi,
pagina 697
Organo Ufficiale
dell’Istituto Italiano della Saldatura
Direzione - Redazione - Pubblicità:
Lungobisagno lstria, 15 ∙ 16141 Genova
Telefono: 010 8341475 ∙ Fax: 010 8367780
[email protected] ∙ www.iis.it
Abbonamento annuale 2012
Italia: ……………..……€ 100.00
Estero: ………….……...€ 170.00
Un numero separato:... € 26.00
La Rivista viene inviata gratuitamente ai Soci
dell’Istituto Italiano della Saldatura.
Rivista associata
Registrazione al ROC n° 5042 - Tariffa regime
libero: “Poste Italiane SpA - Spedizione in
Abbonamento Postale 70%, DCB Genova”
Fine Stampa Ottobre 2012
Aut. Trib. Genova 341 - 20.04.1955
Stampa: ALGRAPHY S.r.l. - Genova - www.algraphy.it
L’Istituto non assume responsabilità per le opinioni espresse
dagli Autori. La riproduzione degli articoli pubblicati è
permessa purché ne sia citata la fonte, ne sia stata concessa
l’autorizzazione da parte della Direzione della Rivista, e sia
trascorso un periodo non inferiore a tre mesi dalla data della
pubblicazione. La collaborazione è aperta a tutti, Soci e non
Soci, in Italia e all’Estero. La Direzione della Rivista si riserva
di accettare o meno, a suo insindacabile e privato giudizio,
le inserzioni pubblicitarie. Ai sensi del D. Lgs. 196/2003, i
dati personali dei destinatari della Rivista saranno oggetto
di trattamento nel rispetto della riservatezza, dei diritti della
persona e per finalità strettamente connesse e strumentali
all’invio della pubblicazione e ad eventuali comunicazioni ad
esse correlate.
Nel prossimo numero parleremo di...
´/DJJDQ7RUPRUH([SRUW3LSHOLQHµDSSOLFD]LRQHGLÀOL
1Ni per saldatura orbitale NG-GMAW di giunti di
forte spessore ad elevata resistenza e tenacità
2
12
1
01
012
0
20
2
N. 1 * 2012
V - N.
LXIV
no LXIV
- anno
Aprile
tura
della Salda
zo -
o Italiano
dell’Istitut
Mar
Ufficiale
Org
ano
- Con
tien
e IP
Perçue ordinario
- Contiene
+ Sup
plem
ento
- Bim
estr
Organo
ale
ento - Bimestra
IP + Supplem
Febbraio
le Gennaio-
201
2 ISS
N:0035
-6794
2012 ISSN:003
5-6794
Articoli
Uffic
ia
le de
ll’I
stitu
no
della
Sald
atur
aanno
* 2012
794
Resistenza meccanica e a corrosione di giunti
simili a sovrapposizione saldati mediante FSW
035-6
N:0
ISS
- Giu
ggio
Ma
le
estra
- Bim
ento
pplem
Tari
+ Su
(I) -
- Co
nti
ene
IP
– 161
41 Gen
ova
er
Errnest Lerev
icana
rio
Org
an
oU
ffi
rçu
Lun
gob
isag
no Istr
e ord
ina
ia, 15
agno
– Lungobis
Pe
- Ta
xe
le
am
gata
Pa
t
cia
oria
o
na ssttto
na
un
u
de
ll’Is
titu
to
Ita
lia
no
de
lla
Sa
ld
atu
DC
Italiano
B Ge
dell
nova
a Sal
” Ta
ssa
datu
ra –
della Saldatura
Istituto Italiano
- N.
2
gno
iane
libe
ro: “Po
ste Ital
ffa reg
ime
- Tariffa regime
Genova (I)
– 16141
Istria, 15
LXIV
2012
SpA
libero: “Poste
- Spe
d. A.P.
Italiane SpA
70%
, DCB
- Sped. A.P.
70%, DCB
Gen
ova”
Tassa
Pag
ata
Genova” Tassa
- Tax
e Per
çue
ordi
Pagata - Taxe
nario
to Ita
lia
-a
n
no
ed.
Istit
uto
A.P
. 70
%,
ra
LX
-N
.
3
*2
01
2
Sa
lda
tur
a–
Lung
obisa
gno
Istria
, 15
– 16
141
Ge
nova
(I)
- Ta
riff
a reg
im
e lib
ero
: “P
oste
Ita
lia
ne
Sp
A-
Sp
IV
Valutazione della “Minimum Pressurizing Temperature”
(MPT) per reattori di elevato spessore realizzati in acciai
bassolegati al Cr-Mo, in esercizio
in condizioni di “hydrogen charging”
Istitu
to
Ita
lia
no
della
Robotica ed automazione dei processi saldati:
traguardi acquisiti e prospettive future
rio
- Co
ntie
ne
IP
+ Su
pp
lem
en
to
- Bi
mes
tra
le
Se
tte
mbr
e-
Ot
tobr
e 20
12
IS
SN
:003
5-
67
94
Nuove soluzioni di monitoraggio di processo
QHOODVDOGDWXUDODVHULQÀEUDGLOHJKHGLWLWDQLR
dina
O
International Institute of Welding (IIW)
rçue
or
rg
an
Pe
o
U
xe
ffic
- Ta
ia
a Pa
ga
ta
le
de
ll’I
” Ta
ss
sti
tu
B
Ge
no
va
to
Ita
li
, DC
an
70
%
o
de
- Sp
ed
. A.
P.
lla
Sa
ld
Sp
A
atu
Ita
lia
ne
ra
TIG weld penetration improvement by
laser-activated process with oxygen
-a
te
nn
o:
“P
os
o
LX
e lib
er
IV
gim
-N
*2
01
2
no
va
(I)
- Ta
rif
fa
re
.5
Ist
itu
to
Ita
lia
no
de
lla
Sa
ldat
ur
a–
Lu
ng
ob
isa
gn
o Ist
ria
, 15
– 16
14
1 Ge
Ge
Por nova
to , 23
Ant -2
ico 4 M
di G agg
eno io 2
va, 013
Cen
tut
tro
ti g
Con
lili a
gre
gg
Gio
rna
te
Na
Didattica
z
io
ssi
ioi r
nam n a l
id
ent
iS
ia
pag
ald
iinna
atu
00
0
r
a
Criteri per la stesura di WPS
secondo ASME BPV Sezione IX
6
6e Yuoi inYiare un articolo una riÁessione un Tuesito o altro Pateriale che ritieni
Sossa essere di interesse Ser la coPunitj di esSerti e di aSSassionati di saldatura
della Rivista, puoi inviare il tuo gradito contributo all’indirizzo:
[email protected]
Istruzioni per la presentazione degli articoli
L’ articolo pervenuto sarà sottoposto all’esame del Comitato di Redazione che ne vaglierà i contenuti per l’accettazione.
Gli Autori saranno prontamente informati delle decisioni del Comitato di Redazione.
/·DUWLFRORDSSURYDWRSHUODSXEEOLFD]LRQHGRYUjSHUYHQLUHDOOD5HGD]LRQHHQWURLWHUPLQLÀVVDWLFRPSOHWRGL
‡ WLWRORGHÀQLWLYR
‡
breve curriculum dell’Autore/i
‡
abstract in italiano ed in inglese
‡ WHVWRLQÀOH:RUGFDUDWWHUH7LPHV/76WGSW
‡ WDEHOOHHGLPPDJLQLDGDOWDGHÀQL]LRQHRJQLVLQJRODWDEHOODHRÀJXUDGHYHHVVHUHFRUUHGDWDGHOODUHODWLYDGLGDVFDOLD
‡ VHHVLVWHQWHODELEOLRJUDÀDGHYHHVVHUHULSRUWDWDQHOORVWHVVRRUGLQHGLFLWD]LRQHQHOWHVWRFRPHGDHVHPSLR
>@/H]]L)H0XUJLD0©5LVFKLFRQQHVVLDOODVDOGDWXUDHSURFHGXUHGLSURWH]LRQHª5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQSS
Editoriale
Il primato
dell’aritmetica
U
na significativa quantità di abitanti del bel Paese (soprattutto, ma non
solo, quelli appartenenti al generone
elitario e radical-chic) trovano conveniente ostentare in pubblico la loro
scarsa familiarità con i “numeri” (io
per i “numeri” ho avuto sempre poca
simpatia!). Con ciò volendo implicitamente significare di averne, invece,
una maggiore con le “parole”.
Che, fra l’altro, meglio si adattano ai
salotti culturali ed agli eventi nazional - popolari.
Questa situazione trova le sue ragioni di essere se ai “numeri” si associa,
come si conviene, una sobrietà di comunicazione che non è sempre indispensabile con le “parole”.
Anzi!
Inoltre “i numeri” non concedono alcunché all’interpretazione (2 + 2 fa
sempre inesorabilmente 4), al contrario delle “parole” con le quali è sempre
possibile dare luogo a qualche variazione interpretativa.
Non che alle “parole” siano necessariamente applicabili una scarsa sobrietà (c’è anche chi smette di parlare
quando ha esaurito le cose da dire) o
variazioni interpretative (c’è anche chi
considera le cose dette come un obbligo
morale) e, tuttavia, il contesto dei “numeri” e quello delle “parole” si pongono diversamente, per dirla all’inglese,
nei confronti dell’unicità e della stabilità dell’“output”.
Tutto ciò diventa assolutamente evidente quando si entra nel mondo fantasioso della politica economica del bel
Paese, che pure di “numeri” si dovrebbe nutrire.
Non “numeri” complessi per carità
(quali i “differenziali di ordine superiore” che popolano l’ambiente esclusivo della matematica, per intendersi);
ma, al contrario, “numeri” semplici
che afferiscono all’ambiente più popolare dell’aritmetica (come le quattro
operazioni o, al limite, anche soltanto
le due più elementari - somma e sottrazione - sempre per intenderci).
A questo contesto di “numeri” semplici (ma reso complesso da convenienze
le più varie) si adatta perfettamente un
approccio da casalinga tradizionale
(Dio ci conservi le poche che restano
e, possibilmente, ce ne mandi qualche
altra), che deve far quadrare i conti.
Essendo digiuna di scienza finanziaria,
la casalinga tradizionale non pensa di
poter spendere di più di quanto dispone, né tantomeno che le spese correnti possano costantemente aumentare
quando non si riesce a mantenere il
passo con le medesime.
Né pensa (essendo sempre digiuna di
scienza finanziaria) che il fare debiti
possa essere finanziato all’infinito facendo altri debiti, in previsione di uno
sviluppo salvifico che tutto ripiana.
Né, infine, ritiene (non avendo competenze neppure nel settore dell’“International Banking”) di poter
dare la colpa ai cattivi di turno, che
non la capiscono e non tengono conto
delle sue sacrosante esigenze sociali.
In una situazione di non equilibrio, la
casalinga tradizionale, molto semplicemente, disponendo soltanto delle
quattro operazioni dell’aritmetica, comincia a risparmiare e a pagare i debiti.
Punto!
Così il mondo dei “numeri” semplici,
ma non così il mondo delle “parole”.
Che fluiscono copiose dalla bocca dei
molti “esperti” in servizio permanente effettivo, con o senza patente, più o
meno prestigiosa, appartenenti a tutti
gli orientamenti della scienza (sic!)
economico – finanziaria.
Di regola in disaccordo fra loro.
Soltanto d’accordo nel non ridurre la
loro “competenza” all’impiego banale
dei “numeri” semplici.
Ma non saranno le “technicalities”
economico - finanziarie a risolvere i
problemi di fondo.
Come ha perfettamente capito, nella
sua concretezza, la casalinga tradizionale. Per i problemi di fondo occorrono (non solo ma anche) i “numeri”
semplici.
Verso i quali, tuttavia, una significativa quantità degli abitanti del bel Paese
non è affatto vocata.
Ad maiora.
Dott. Ing. Mauro Scasso
Segretario Generale IIS
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
593
Taglio di precisione per dettagli d’alta classe
Gas, tecnologie e servizi per il taglio e la saldatura
Rivoira offre soluzioni dedicate agli operatori
del settore manifatturiero Metal Fabrication,
in cui opera con successo dall’inizio del secolo scorso.
L’offerta Rivoira comprende le linee di gas e
miscele LaserStarTM e STARGAS®, dedicate
rispettivamente alle applicazioni di taglio laser
ed ai processi di saldatura.
La qualità dei prodotti e dei servizi forniti,
così come la volontà di soddisfare le esigenze
e le aspettative dei propri clienti sono alla base
del successo Rivoira.
Rivoira S.p.A. - Gruppo Praxair
Tel. 199.133.133* - Fax 800.849.428
[email protected]
* il costo della chiamata è determinato dall’operatore utilizzato.
www.rivoiragas.com
Alcuni metodi per la valutazione della
suscettibilità al fenomeno delle cricche
da riscaldo (reheat cracking) della zona
fusa dell’acciaio 2.25Cr 1Mo 1/4V:
Gleeble test®, GDMS, trazione a caldo
(Mini JIP Project)
A. Bertoni *
C. Chovet **
Sommario / Summary
Nel recente passato fenomeni di reheat cracking sono
stati messi in evidenza nella zona fusa del materiale
2,25Cr 1Mo 1/4V durante la fabbricazione dei reattori di
grande spessore. I due metodi, sviluppati per la verifica
della sensibilità della zona fusa al fenomeno, sono stati
uno chimico, basato sulla metodica Glow Discharge Mass
Spectrometry, che ha dato origine al parametro Kf ed uno
meccanico, non standardizzato, che consiste in una prova
Gleeble® di trazione a caldo eseguita a bassa velocità di deformazione. I risultati ottenuti con la prova Gleeble® hanno
messo in evidenza la loro dipendenza da alcuni parametri
di esecuzione della prova stessa rendendo il test non eseguibile in altri laboratori se non in quello del Centro di
Ricerca di Industeel. Per il superamento di questo limite il
progetto europeo Mini JIP ha preso vita all’inizio del 2010.
Il presente lavoro vuole riassumere la descrizione dei due
metodi di prova sviluppati per l’identificazione delle cause
di questo fenomeno e dare indicazioni relative ai risultati
ottenuti nel progetto Mini JIP.
(°) Memoria presentata alle Giornate Nazionali di Saldatura 6,
Workshop: “Metallurgia e Saldabilità”, Genova 26-27 Maggio 2011
* Air Liquide Welding Oerlikon - Verona
** Air Liquide CTAS - Saint Ouen L’Aumone - Paris
In the recent past, reheat cracking phenomena have been
shown in 2.25 Cr 1Mo 1/4V weld metal of heavy wall pressure vessels. For monitoring these phenomena, chemical
and mechanical methods have been developed: Glow Discharge Mass Spectrometry method, which gave Kf parameter, and Gleeble® thermo-mechanical test, performed at
low strain rate. Depending on a few Gleeble® test parameters, the test results couldn’t be obtained in laboratories
other than Industeel Research Centre. To overcome this
limit, European Mini JIP project started in early 2010.
This paper describes these two test methods developed for
monitoring these phenomena and giving a Mini JIP project
achievement report.
IIW Thesaurus Keywords:
Chemical engineering; creep resisting materials; elevated
temperature strength; high temperature; hot cracking;
influencing factors; low alloy Cr Mo steels; mechanical
properties; oil industry; post weld heat treatment; reheat
cracking; tensile tests; weld metal; weldability; weldability tests.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
595
A. Bertoni e C. Chovet - Alcuni metodi per la valutazione della suscettibilità al fenomeno delle cricche da riscaldo (reheat cracking) della ZF...
1. Introduzione
Il fenomeno del reheat cracking, nei materiali bassolegati al
CrMo, si evidenzia con la presenza di cricche intergranulari
che si sviluppano in un intervallo di temperatura compreso
tra i 500 °C ed i 700 °C.
Il meccanismo classico che origina il fenomeno è legato, in
questo campo di temperature, all’effetto combinato del rilassamento delle tensioni residue, alla precipitazione di carburi
a bordo grano, in grado di provocare un indurimento secondario riducendo localmente la plasticità della microstruttura
ed alla segregazione, anche questa a bordo grano, di elementi come P, As, Sn, S, Sb, in grado di creare un ulteriore indebolimento del bordo del grano, il quale diviene sede preferenziale del fenomeno di decoesione intergranulare tipico
del RHC.
Allo svilupparsi del fenomeno contribuiscono le dimensioni
del grano, le tensioni residue presenti nel giunto, la composizione chimica e le proprietà meccaniche del materiale
stesso. La letteratura tecnica relativa al fenomeno di reheat
cracking (RHC) [1-2-3-4-5], che prende in considerazione
gli acciai bassolegati del tipo CrMo, progettati per servizio
ad alta temperatura (grado 11, 22, 23, 24, 91), evidenzia
come sede più favorevole per l’instaurarsi della difettosità la
zona termicamente alterata del materiale base.
Nel recente passato sono stati riscontrati casi di reheat cracking non nella zona termicamente alterata, ma nella zona
fusa del materiale 2,25Cr 1Mo 1/4V [6-11].
A fronte di questo particolare fenomeno, non riscontrato in
precedenza, numerosi studi sono stati eseguiti per la determinazione delle cause.
Le verifiche eseguite hanno confermato che le proprietà chimiche e meccaniche della zona fusa rispettavano, con ampio
margine, i requisiti delle più stringenti specifiche tecniche e
degli standard applicabili.
I ricercatori del Centro di Ricerca dell’Industeel hanno quindi sviluppato una variante della prova meccanica Gleeble®,
596
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
utilizzata prevalentemente per la valutazione della sensibilità del materiale base a RHC e hanno definito una procedura del test capace di identificare il grado di sensibilità della
zona fusa a tale fenomeno. In aggiunta a questa prova, un’inusuale metodica di analisi chimica (Grow Discharge Mass
Spectrometry), venne introdotta per la determinazione degli
elementi chimici che sono sembrati maggiormente influenzanti l’insorgere del fenomeno.
L’estesa sperimentazione mise in evidenza che i risultati
della prova meccanica Gleeble® erano fortemente influenzati dalla variazione di alcuni parametri di esecuzione della
prova stessa, rendendo di fatto possibile eseguire tale prova
unicamente nel laboratorio di ricerca nel quale la prova era
stata sviluppata e definita.
Per affrancarsi da questo limite, un’attività di ricerca europea denominata “Mini JIP” ha validato, dopo un anno d’intensa attività, una procedura per l’esecuzione di una prova
di trazione a caldo tale da risultare tecnicamente equivalente
alla prova Gleeble®, ma di più semplice esecuzione e permettendone l’esecuzione su macchine di trazione considerabili convenzionali.
La nuova procedura verrà presentata ufficialmente al convegno API e successivamente alla ASME, per la sua accettazione ed introduzione nello standard.
Questo importante passo permetterà quindi di rendere l’esecuzione della prova di valutazione della sensibilità della
zona fusa del materiale 2¼Cr 1Mo ¼V al RHC accessibile
ad un grande numero di laboratori, consentendo una più diffusa e semplice valutazione del fenomeno.
Il presente lavoro vuole ricapitolare i diversi metodi di prova
sopra citati, fornire alcune osservazioni relative a tali test e,
nel quadro delle attività di divulgazione del progetto “Mini
JIP”, indicare i risultati ottenuti sugli aspetti valutati nel programma di ricerca.
2. Descrizione del fenomeno reheat cracking in
zona fusa
Il materiale 2¼Cr 1Mo ¼V è stato introdotto nella fabbricazione dei componenti a pressione di grosso spessore dedicati
all’industria petrolchimica alla fine degli anni ‘90, come soluzione alternativa al materiale 2¼Cr 1Mo convenzionale.
I vantaggi dell’acciaio modificato al V risiedono nelle più
elevate proprietà meccaniche, sia a temperatura ambiente
che ad alta temperatura e alla più elevata resistenza all’infragilimento e all’attacco da idrogeno rispetto al materiale
convenzionale, grazie alla presenza dei carburi di V che riducono la mobilità dell’idrogeno nell’acciaio.
Al materiale modificato al V viene attribuita una maggiore
sollecitazione ammissibile, rispetto al materiale convenzionale, permettendo il suo utilizzo a temperature e pressioni di
esercizio più elevate e consentendo una significativa riduzione dello spessore e del peso del componente.
Conseguenza di queste elevate prestazioni operative il materiale al V presenta alcune complessità nelle fasi di fabbricazione dovute principalmente alle altissime caratteristiche
A. Bertoni e C. Chovet - Alcuni metodi per la valutazione della suscettibilità al fenomeno delle cricche da riscaldo (reheat cracking) della ZF...
Figura 1 - Andamento intergranulare delle cricche da rinvenimento
TABELLA 1 - Parametri classici per la valutazione della sensibilità
al RHC
Parametri classici per la valutazione della
sensibilità a RHC
P d0,010
X-bar = 10P + 5Sb + 4Sn + As < 12
MCF = Si + 2Cu + 2P + 15As + 20Sb + 15Sn < 0,8
¨G = Cr + 3,3Mo + 8,1V - 2 < 0
¨G1 = Cr +3,3Mo + 8,1V +10C - 2 < 2
P sr = Cr + Cu + 2Mo + 10V + 7Nb + 5Ti - 2 < 0
Rs = 0,12Cu + 0,19S + 0,1As + P + 1,18Sn + 1,49Sb
tensili (TS 1000-1200 MPa) ed alla tenacità molto limitata
(10-20 J) a temperatura ambiente nello stato come saldato
o dopo trattamento di deidrogenazione (Dehydrogenation
Treatment) [9].
Per impartire alla zona fusa una maggiore tenacità si impone, in generale, la necessità di eseguire un trattamento intermedio di stress relieving (Intermediate Stress Relieving) nel
campo delle temperature 650-680 °C il cui scopo è quello di
ridurre significativamente le tensioni residue presenti nel
giunto e promuovere l’iniziale trasformazione della microstruttura martensitica incrementando la tenacità della
zona fusa a valori compresi tra i 70 e 180 J, a temperatura
ambiente [9 – 10].
Nella fase di esecuzione del trattamento di ISR durante la
fabbricazione dei componenti a pressione è stato evidenziato
l’insorgere delle cricche da rinvenimento localizzate nella
zona fusa mediante controllo ultrasonoro e TOFD (Time Of
Flight Diffraction) molto accurati ed eseguiti con sensibilità molto più elevate rispetto a quanto richiesto dal Codice
ASME [11].
Le cricche, originatesi durante l’esecuzione del trattamento
termico ISR, sono state riscontrate in giunti di produzione ad
alto grado di vincolo - in cui le tensioni residue hanno contribuito significativamente all’esaltazione del fenomeno - e
saldati mediante procedimento ad arco sommerso monofilo
e tandem.
A dimostrazione del ruolo delle tensioni
residue nel fenomeno, è stato fatto notare
che la zona fusa di giunti eseguiti per la
costruzione di talloni, finalizzati a qualifiche di procedimento o talloni di produzione, sono risultati esenti dal fenomeno.
Le dimensioni delle difettosità sono state
molto contenute, 3-5 mm, con orientamento trasversale all’asse dei giunti e con
morfologia intergranulare, come rappresentato nella Figura 1 [6-11].
3. Descrizione dei metodi chimici e meccanici
3.1 Metodo chimico: GDMS e Kf
Nel corso degli anni numerose formule basate sull’influenza
di vari elementi chimici, ritenuti responsabili della sensibilità dei materiali bassolegati CrMo al fenomeno del RHC,
sono state proposte e pubblicate da diversi autori [5-12-1314]. Storicamente il fenomeno è stato principalmente considerato localizzato nella zona termicamente alterata del materiale base come mostrato nella Figura 2 e le formule sono
state definite per la valutazione di questo tipo di difettosità.
Classicamente, gli elementi chimici considerati promotori
del fenomeno sono tutti quelli fragilizzanti come P, Sn, As,
Sb, S e quelli che causano una precipitazione fine e dispersa
a bordo grano, introducendo un indurimento secondario localizzato come C, V, Nb, Si, Cu, Mo, Ti, Cr.
Ad ognuno di questi elementi chimici, nelle diverse formule,
viene attribuito un coefficiente diverso a seconda del tipo di
materiale considerato e della problematica incontrata.
La Tabella 1 riporta alcune delle più importanti formule
adottate inizialmente per una prima valutazione del RHC in
zona fusa. Nessuna di queste formule ha originato l’individuazione della causa del fenomeno.
Questa analisi ha dimostrato che nessun elemento chimico,
valutato singolarmente o come combinazione di più elementi tra quelli considerati impurezze (P, Sn, S, As, Sb) o come
Figura 2 - RHC in zona termicamente alterata
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
597
A. Bertoni e C. Chovet - Alcuni metodi per la valutazione della suscettibilità al fenomeno delle cricche da riscaldo (reheat cracking) della ZF...
TABELLA 2 - Condizioni di saldatura del giunto per l’esecuzione della
prova di trazione lenta e a caldo Gleeble®
SAW MONOFILO
Filo diametro
3,2
4
Tipo di Corrente
AC
AC
510 A
550 A
Volt
31
31
Stick out (mm)
25
30
Velocità (mm/1’)
500
500
Apporto termico (KJ/mm)
1,9
2,05
Preriscaldo - interpass (°C)
200-250
200-250
DHT (°C x h)
350 x 4
350 x 4
Corrente
partecipante principale al bilanciamento dell’analisi chimica
della zona fusa (C, Si, Cr, Mo, V, Nb, Ti), era responsabile
del fenomeno sotto valutazione.
L’introduzione dell’inusuale metodica di analisi chimica
GDMS, Glow Discharge Mass Spectrometry, ha permesso
di misurare contemporaneamente, con elevatissima accuratezza (ppb), ben 75 elementi chimici. In questo modo è stato
possibile valutare un grande numero di impurezze mai analizzate in precedenza con questo livello di precisione.
I risultati dell’analisi hanno messo in evidenza che la concentrazione degli elementi residuali critici era a livelli così
bassi che non potevano essere misurati con la necessaria accuratezza mediante i metodi convenzionali come ad esempio
ICP-AES, la cui accuratezza è dell’ordine della ppm.
L’analisi ha portato all’identificazione degli elementi ritenuti
responsabili del fenomeno: Pb, Sb e Bi.
3.2 Metodo meccanico
3.2.1 Prova di Gleeble®: trazione a caldo eseguita a
bassissima velocità di deformazione
La prova, non è definita da uno standard ma è stata sviluppata
dal Centro di Ricerca dell’Industeel basandosi sulla propria
ampia esperienza maturata nella valutazione della sensibilità
598
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
Figura 3 - Posizione di prelevamento dei provini
Figura 4 - Dimensioni del provino di trazione
al RHC dei materiali base. Le condizioni di prova, previste
per la valutazione del materiale base, sono state modificate
e adattate per poter ottenere risultati che rappresentassero il
livello di sensibilità al fenomeno da parte della zona fusa. La
procedura prevede:
r l’esecuzione di un giunto nelle condizioni riportate nella Tabella 2;
r l’estrazione di due provini di trazione come riportato
nella Figura 3;
r l’esecuzione della prova di trazione a caldo come riportato nella Tabella 3.
Le condizioni di prelevamento dal giunto e la configurazione geometrica dei provini di trazione sono mostrate nelle
Figure 3 e 4. La procedura di esecuzione della prova di trazione a caldo Gleeble® viene sinteticamente riportata nella
Tabella 3. I risultati ottenuti nella prova Gleeble® vengono
riportati nella Figura 5, dove le curve rossa e violetta indicano materiali sensibili al RHC, mentre le curve blu e azzurra
indicano materiali esenti dal fenomeno.
Inizialmente la prova è stata eseguita a diverse temperature (550, 600, 620, 650, 680, 705 °C) per individuare quella
A. Bertoni e C. Chovet - Alcuni metodi per la valutazione della suscettibilità al fenomeno delle cricche da riscaldo (reheat cracking) della ZF...
maggiormente critica. Il minimo delle curve è concentrato
principalmente in corrispondenza della temperatura di 650 °C
e questa temperatura è stata scelta come quella più rappresentativa per la valutazione della sensibilità del materiale e
alla quale eseguire la prova.
Sulla base di questi risultati è stato definito il criterio di accettazione della prova per il quale la RoA deve risultare superiore al 23%, affinché il materiale venga considerato non
sensibile al fenomeno.
TABELLA 3 - Condizioni di esecuzione della prova di Gleeble®
Ambiente del forno per il
riscaldamento
Vuoto 10-2 Pa
N° termocoppie applicate a contatto
Riscaldamento alla temperatura di
prova
Temperatura di prova (°C)
4. Correlazione tra Kf e prova di Gleeble®:
deÀnizione del criterio di accettabilità del Kf
Mantenimento alla temperatura
di prova prima dell’inizio
dell’applicazione del carico
Incrociando i risultati ottenuti con l’analisi GDMS e quelli
derivanti dalla prova di Gleeble®, il nuovo fattore Kf è stato
definito da Chauvy e Pillot (Industeel) [6] .
Tale fattore considera gli elementi Pb, Sb e Bi come impurezze sensibili al fenomeno:
Velocità di deformazione
Kf = Pb + Bi + 0,03 * Sb ≤ 1,5 ppm
La copiosa sperimentazione ha permesso di definire con notevole precisione la correlazione tra il valore di Kf ed i valori
di RoA determinati tramite la prova di Gleeble®.
Il grafico della Figura 6 dimostra come il valore massimo
accettabile del Kf ≤ 1,5 ppm sia quello che garantisce un
materiale di saldatura esente da questo tipo di RHC.
Per Kf inferiore a 1,5 ppm i valori di RoA risultano superiori
alla soglia del 23% che corrisponde all’area del diagramma
di Figura 6 definito come “No RHC”.
2o3
3 minuti
+650
30 minuti
0,0025 mm/sec
Criterio di accettabilità:
Strizione Z (%)
(Reduction of Area - RoA)
•
TABELLA 4 - Effetto della velocità di deformazione sul valore della
RoA
Velocità di
deformazione
0,0025 mm/sec
§PPVHF
Temperatura di prova
+650 °C
+620 °C
RoA 13%
RoA 16%
RoA 22%
RoA 26%
5. Osservazioni sulla prova Gleeble®
menta anche il valore di RoA. Il confronto dell’effetto della
velocità di deformazione sul valore di RoA misurato è riportato nella Tabella 4. Si vede quindi come la velocità di prova
influenzi il risultato e possa portare a risultati considerati
accettabili a fronte di un materiale sensibile al fenomeno.
5.1
5.2
Effetto della velocità di prova
Effetto del trattamento termico dopo saldatura:
DHT e ISR
I risultati ottenuti nei diversi laboratori coinvolti nella sperimentazione hanno messo in evidenza quanto questi siano dipendenti da alcuni parametri di esecuzione della prova stessa
e principalmente dalla velocità di deformazione.
All’aumentare della velocità di esecuzione della prova au-
L’effetto del trattamento di ISR sul risultato della prova di
Gleeble® è stato valutato utilizzando uno stesso giunto saldato in accordo alla procedura ed eseguendo su una parte
di questo il trattamento di DHT 350 °C x 4 h e sull’altra
Figura 5 - Andamento della prova di Gleeble®: curve rossa e viola
indicano materiale sensibile al RHC, curve blu e azzurra indicano
materiale NON sensibile al RHC
Figura 6 - Correlazione tra Kf e Gleeble®
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
599
A. Bertoni e C. Chovet - Alcuni metodi per la valutazione della suscettibilità al fenomeno delle cricche da riscaldo (reheat cracking) della ZF...
un trattamento di ISR a 670 °C x 4 h. I risultati ottenuti,
riportati nella Figura 7, evidenziano come il trattamento di
ISR favorisca l’ottenimento di risultati ben superiori a quelli
ottenuti con materiale sottoposto al solo trattamento di DHT.
6. Mini JIP: prova di trazione a caldo alternativa
alla prova di Gleeble®
Come indicato nel Paragrafo precedente, i risultati della prova di Gleeble® hanno messo in evidenza la loro suscettibilità alla velocità di applicazione della deformazione. Questo
aspetto ha condizionato la scelta del laboratorio nel quale
poter eseguire con affidabilità e ripetitività di risultati la
prova. Il laboratorio del Centro di Ricerca di Industeel, nel
quale la prova è stata creata e procedurizzata, è stato l’unico
considerato affidabile e questo ha limitato la possibilità di
una maggiore sperimentazione.
Per superare questa limitazione è stato lanciato, all’inizio
del 2010, un progetto di ricerca europeo denominato “Mini
JIP” [12]. Questa ricerca, sovvenzionata da numerosi costruttori italiani e alla quale hanno contribuito i principali
fornitori di materiale d’apporto europei, con l’indispensabile
supporto di Industeel ed il coordinamento di Fluor Enterprises, ha voluto valutare la possibilità di individuare una prova
di trazione a caldo che potesse essere eseguita in modo più
semplice, pur mantenendo l’affidabilità e la rappresentatività
dei risultati, rispetto alla prova di Gleeble®.
Lo scopo ultimo è stato quello di poter qualificare un numero più esteso di laboratori in grado di eseguire la prova di
trazione a caldo. Tutti i parametri che caratterizzano la prova
di Gleeble® sono stati verificati considerando:
r il fattore Kf, suddividendo i materiali in tre classi
Kf << 1; Kf ≈ 1,5; Kf >> 1,5 ppm;
r la procedura di saldatura del tallone dal quale prelevare
i provini di trazione;
r la temperatura di prova valutando: 620 °C, 650 °C,
670 °C, 705 °C;
r le condizioni di trattamento termico post saldatura
(DHT, DHT + ISR);
r l’effetto dell’atmosfera da utilizzare nel fornetto della
macchina di trazione considerando vuoto, aria, elio;
r l’effetto della velocità di riscaldamento alla temperatura
di prova 400 °C/h, 2000 °C/h, 12000 °C/h;
r il tempo di mantenimento alla temperatura di prova prima dell’applicazione del carico 0’, 3’, 20’, 90’;
r l’effetto combinato della velocità di riscaldamento e del
tempo di mantenimento alla temperatura di prova;
r l’effetto della velocità di deformazione;
r la ripetitività del test condotto nelle nuove condizioni di
prova, verifica svolta in 4 laboratori.
I risultati ottenuti, a seguito dell’estesa campagna sperimentale, hanno permesso di definire con maggiore precisione
i campi di validità di ogni variabile all’interno dei quali la
prova di trazione a caldo risulta rappresentativa ed equivalente alla prova di Gleeble®.
Il criterio di suddivisione del livello di criticità dei materiali
600
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
Figura 7 - Comparazione dell’effetto del trattamento termico di ISR
sul valore RoA
basato sulle tre classi di Kf, la procedura di esecuzione del
tallone di saldatura, le condizioni di prelevamento dei provini di trazione sono stati confermati.
La temperatura di +650 °C, a cui eseguire la prova, rimane confermata come quella più selettiva. Viene confermato
l’effetto del trattamento termico di ISR che promuove valori
della RoA estremamente più elevati rispetto a quelli ottenuti con il solo trattamento di DHT. Favorevole all’utilizzo di
macchine di trazione convenzionali è stato l’innalzamento
della velocità di applicazione della deformazione e la possibilità di non utilizzare camere di riscaldamento sotto vuoto.
Notevole influenza, sul valore della RoA, è stata attribuita
sia al gradiente di riscaldamento che al tempo di mantenimento alla temperatura di prova.
L’aumento del tempo di mantenimento e la diminuzione del
gradiente di riscaldamento comportano un innalzamento dei
valori di RoA rispetto ai valori ottenuti con la “classica” prova di Gleeble®.
Il Round Robin ha anche evidenziato che 3 laboratori su 4
hanno ottenuto risultati tra loro equivalenti. Le cause dei
risultati disomogenei ottenuti da uno dei quattro laboratori
non sono ancora state chiarite e sono in via di valutazione.
La procedura della prova di trazione a caldo nella sua versione finale è ancora in via di completamento e verrà prima
sottoposta alla valutazione ed accettazione API e poi a quella
ASME, con lo scopo di renderla approvata come prova standardizzata ed applicabile nel campo della fabbricazione dei
componenti a pressione dedicati all’industria petrolchimica.
7. Considerazioni relative ai prodotti di consumo
industriali
Air Liquide Welding Oerlikon, fin dagli anni ‘90 è protagonista nello scenario dell’industria petrolchimica con i
prodotti di consumo dedicati alla saldatura dei materiali
2¼Cr 1Mo ¼V con procedimento arco sommerso filo
OE CROMO S225V e flusso OP CROMO F537 ed elettrodi
OE CROMO E225V.
Questi materiali garantiscono il soddisfacimento di tutti i
requisiti “classici” più restrittivi delle specifiche tecniche
A. Bertoni e C. Chovet - Alcuni metodi per la valutazione della suscettibilità al fenomeno delle cricche da riscaldo (reheat cracking) della ZF...
TABELLA 5 - Valori di Kf e RoA ottenuti nelle verifiche industriali dei
prodotti CROMO S225V e OP CROMO F537
Kf < 1,5 (ppm)
RHC test at +650 °C
RoA () • 23
0,4 – 0,8
25 – 45
(X-bar, PE, prova di step cooling, tenacità a -30 °C, proprietà meccaniche a temperatura ambiente e ad alta temperatura
dopo il minimo e massimo ciclo di trattamento termico di
distensione) e dei criteri di accettabilità relativi al fattore Kf
e della prova di Gleeble®.
Nella Figura 8 viene riportato l’andamento della prova di
step cooling dopo trattamento di distensione minimo eseguito a 710 °C x 8 h. Nella Tabella 5 vengono riportati i campi
dei valori riscontrati sia per Kf che per RoA.
Air Liquide Welding Oerlikon ha introdotto nelle proprie
procedure di qualità la verifica chimica GDMS per il calcolo
del fattore Kf e la prova di Gleeble®.
Sulla base di questi criteri più di 3000 t di prodotti hanno
largamente soddisfatto i requisiti indicati grazie all’accurata
selezione delle materie prime necessarie per la fabbricazione
dei prodotti di consumo.
8. Conclusioni
Il fenomeno di RHC apparso in zona fusa dei giunti saldati
di materiale 2¼Cr 1Mo ¼V è stato studiato e le sue cause
identificate aprendo una nuova pagina nella metallurgia di
questo materiale.
Il Centro di Ricerca dell’Acelor Mittal Industeel ha definito
due metodi di prova finalizzati al controllo dell’adeguatezza
dei materiali di saldatura per il loro utilizzo industriale nella fabbricazione dei componenti a pressione per l’industria
petrolchimica.
Il primo metodo basato sull’analisi chimica GDMS permette
di valutare la concentrazione degli elementi chimici considerati responsabili del fenomeno ed il cui criterio di accettabilità viene rappresentato dalla formula :
Kf = Pb + Sb + 0,03Bi d1,5 ppm
Il secondo metodo basato su una prova di trazione a caldo con velocità di applicazione della deformazione molto
lenta ed eseguita ad alta temperatura (+650 °C) mediante la
Figura 8 - Andamento della tenacità in zona fusa con trattamento minimo PWHT e min PWHT e SC
quale viene misurata la RoA % (Reduction of Area), ovvero
la strizione del provino, detta prova di Gleeble®, prova non
standardizzata. Il criterio di accettabilità è stato definito con
RoA ≥ 23%.
I risultati di questa prova sono apparsi molto sensibili ad alcune variabili come la velocità di applicazione della deformazione o la necessità di eseguire la prova sottovuoto.
Questi aspetti hanno reso possibile eseguire la prova unicamente nel laboratorio del Centro di Ricerca di Acelor Mittal
Industeel.
Il progetto di ricerca “Mini JIP” ha individuato i campi nei
quali i parametri della prova Gleeble® possono essere estesi,
permettendo l’utilizzo di macchine di trazione convenzionali e consentendo di ampliare il numero di laboratori in grado
di poter eseguire la prova.
La nuova procedura di esecuzione della prova a caldo verrà
sottoposta all’approvazione API e ASME per standardizzarla.
Air Liquide Welding Oerlikon ha introdotto nel proprio piano di controllo della qualità della produzione dei materiali
industriali OE CROMO S225V e OP CROMO F537, sviluppati per questa specifica applicazione, la prova GDMS e
Gleeble®.
Questi prodotti di consumo soddisfano ampiamente i più
stringenti requisiti tecnici richiesti dall’industria petrolchimica come Step Cooling Test, le caratteristiche meccaniche
a temperatura ambiente ed ad alta temperatura, la tenacità a
-30 °C, X-f e il PE ed i criteri relativi al Kf che alla prova di
Gleeble®. Oltre 3000 t di materiale sono state validate tramite queste prove ed utilizzate nella costruzione di reattori per
l’industria petrolchimica.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
601
A. Bertoni e C. Chovet - Alcuni metodi per la valutazione della suscettibilità al fenomeno delle cricche da riscaldo (reheat cracking) della ZF...
Riferimenti
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
Nawrocki, DuPont, Robino, et alii “The mechanism of stress relief cracking in ferritic alloy steel”, Welding
Journal, Feb. 2003
Nawrocki, DuPont, Robino, et alii “Stress Relief Cracking susceptibility of a new ferritic steel”, Part 1, Welding
Research Supplement, December 2000
Nawrocki, DuPont, Robino, et alii “Stress Relief Cracking susceptibility of a new ferritic steel”, Part 1, Welding
Research Supplement, January 2001
Tamaky K. “Effect of carbides on reheat cracking sensitivity”, Transaction of Japan Welding Society, April 1984
Lundin C.D., Khan K.K. “Fundamental studies of the metallurgical causes and mitigation of reheat cracking in
1¼Cr-1/2Mo and 2¼Cr-1Mo steels” Welding Research Council Bulletin, Feb. 1996
Cédric Chauvy, Sylvain Pillot “Prevention of weld metal reheat cracking of weld metal during Cr-Mo heavy reactos fabrication”, Proceedings of PVP, July 26-30, 2009, Prague, Czech Republic
Komozo Y., Pargeter R.J. “Synthèse de travaux publiés sur la fragilisation au revenu éversible du metal fondu en
acier au Cr-Mo”, Soudage et Techniques Connexes, Janvier-Février 1990
Hart P.H.M. “The influence of vanadium-microalloying on the weldability of steels”, Vanadium Application
Technology, International Symposium, Beijing, China, 12-14 Oct 2001.
A. Bertoni, C. Bonnet “Characterisation of 2 ¼CrMoV weld metal at different step during manufacturing process
of a pressure vessels”, ESOPE, Paris 2000
S. Pillot, P. Bourges, A. Bertoni, M. Clergè, C. Boucher “Optimisation of ISR and PWHT of CrMoV steel”,
ESOPE, Paris 2004
L. Antalfyy, C. Shargay, D. Smythe, K. Moore “Reheat cracking in heavy wall 2¼Cr-1Mo-¼V reactors welds
and the development of ultrasonic techniques for their discovery”, Proceedings of PVP, July 26-30, 2009,
Prague, Czech Republic
Bruscato R. “Temper embrittlement and creep embrittlement of 2¼Cr-1Mo shielded metal arc weld deposit”,
Welding Journal, Research Supplement 1970
Prager M., Wada T. “Weldability Assessment of 2¼Cr-1Mo-0.3V Pressure Vessel Steel”, New York 1993
Boniszewski T. “Reheat Cracking in 2¼Cr-1Mo SA weld metal”, Metal Construction 1982
Aldo BERTONI, laureato in Ingegneria Mineraria presso l’Università “La Sapienza” di Roma. European Welding Engineer.
Metallurgista della saldatura e dei materiali base. È stato Responsabile del settore Sviluppo e Industrializzazione per la fabbricazione
di elettrodi rivestiti. Attualmente Responsabile Air Liquide Welding del progetto materiali basso legati resistenti allo scorrimento a
caldo - gamma al cromo. Responsabile Marketing Air Liquide Welding Italia per i prodotti di consumo processo arco sommerso. Autore
di circa 15 articoli tecnici relativi alla metallurgia della saldatura e prodotti di consumo.
602
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
Sistemi orbitali per tubi taglio + smusso + saldatura.
> Una unica soluzione completa.
saldatura:
SERIE ORBIWELD TP
AVC/OSC
taglio e smusso:
Saldatrici orbitali a testa aperta di nuova
generazione. Lavorazioni con filo freddo e
complete di controllo tensione d‘arco (AVC)
e pendolamento (OSC).
SERIE GF
La nuova Serie GF fissa i punti di
riferimento per le taglia tubi orbitali!
Numerose funzioni innovative di
ultima generazione combinate ad
una nuova ergonomia creano significativi vantaggi per l’impiego nella
prefabbricazione e montaggio
di piping industriale.
saldatura:
SERIE ORBIMAT
CA AVC/OSC
Generatore compatto a comando
computerizzato per saldatura orbitale,
controllo della tensione d‘arco (AVC)
e del pendolamento (OSC).
saldatura:
SERIE ORBIWELD
Saldatrici orbitali a camera
chiusa ad ingombro ridotto
e massimo rendimento.
smusso:
SERIE REB & BRB
La soluzione più potente per la
smussatura e l’intestatura di tubi.
Consente di realizzare smussi per
saldatura di alta precisione su estremità di tubi per mezzo del sistema
placchetta-portaplacchette QTC®.
Orbitalum Tools GmbH | An IT W Company
Josef-Schuettler-Str. 17, 78224 Singen, Germania
Tel. +49 (0) 77 31 792-0, Fax +49 (0) 77 31 792-524
[email protected], www.orbitalum.com
Vs. contatto in Italia: [email protected]
SOLUZIONI INNOVATIVE
IL CONTROLLO NON DISTRUTTIVO, PERSONALIZZATO
RAGGI-X
Cabine radioscopiche
Digitali - Tomografiche - Personalizzate
Impianti raggi-X portatili
ULTRASUONI
Spessorimetri, flaw detectors,
phased array, sonde speciali,
impianti automatici personalizzati
SPECIALISTI NEL SETTORE CND
Direzione e stabilimenti: Via Arturo Gilardoni, 1 23826 Mandello del Lario (LC) Italy
Tel (+39) 0341-705.111 Fax (+39) 0341-735.046 [email protected] www.gilardoni.it
Saldatura ibrida laser-MIG di giunti a T
in lega di titanio
R. Spina*
D. Sorgente*
M. Brandizzi**
A. A. Satriano**
L. Tricarico*
Sommario / Summary
L’innovazione dei materiali e dei loro processi di giunzione
ha sempre svolto un ruolo fondamentale nell’evoluzione
del settore dei trasporti in generale ed in quello aeronautico in particolare. Fattori primari per l’innovazione continua sono stati il miglioramento delle prestazioni dei materiali e dei processi parallelamente alla riduzione dei costi
degli stessi. Le leghe di titanio, caratterizzate da elevate
proprietà meccaniche e di resistenza alla corrosione, sono
particolarmente interessanti per il settore aeronautico.
La loro giunzione, a partire da lamiere di spessore uguale o
differente, è prevalentemente effettuata con tecniche laser
o ad arco. Utilizzando il solo processo laser, si applica una
elevata quantità di energia in una zona molto limitata in
un tempo molto breve, ottenendo una ridotta zona termicamente alterata. Con il secondo processo, invece, si applica
una grande quantità di calore in una zona più estesa per
un tempo più lungo, ottenendo una zona termicamente alterata più estesa. La combinazione del processo ad elevata
densità di energia (laser) con quello ad elevato apporto energetico (saldatura MIG), ha dimostrato di migliorare gli
effetti benefici di entrambi i processi (Key-hole, abilità di
colmare i gap) pur limitando i loro inconvenienti (elevato
gradiente termico, bassa resistenza meccanica).
In questo lavoro, la saldatura ibrida laser-MIG è stata applicata a giunti a T a piena penetrazione in lega Ti-6Al-4V
a partire da lamiere di 3 mm di spessore, utilizzando una
specifica scarpetta di protezione del gas, dopo aver effettuato delle prove su giunti di testa della stessa lega.
I principali fattori di valutazione sono stati la morfologia
del cordone di saldatura e le considerazioni energetiche di
giunzione.
Innovation in materials and joining processes continues to
play a key role in the evolution of the transport sector, in
general, and in the aviation in particular. Important factors of innovation are the improvement in material and
processes performances, coupled to the associated cost reduction. Titanium alloys, characterized by high mechanical properties and corrosion resistance, are particularly
interesting for the aeronautical sector.
Their joining, from metal sheets with equal or different
thicknesses, is mainly carried out by using laser or arc
welding techniques. With the laser process, a high amount
of energy is applied in a very limited area for a very short
time, resulting in a reduced heat affected zone. With the arc
welding, a large amount of heat is applied in a larger area
for a longer time, obtaining a more extended heat affected
zone. The combination of the process with high energy
density (laser) with the high energy contribute (MIG) has
been shown to enhance the beneficial effects of both processes (key-hole, ability to bridge sheet gap) while limiting
their drawbacks (high thermal gradient, low mechanical
resistance).
In this paper, the hybrid Laser-MIG welding of Ti-6Al-4V
was investigated. The welded joints were obtained from
with 3-mm thick sheets using the double fillet welded Tjoint. The main factors of evaluation were the morphology
of the weld bead and energetic considerations.
IIW Thesaurus Keywords:
Aerospace; combined processes; laser welding; MIG welding; optimisation; penetration; process parameters; T
joints; titanium alloys.
* Dipartimento di Meccanica, Matematica e Management, Politecnico di Bari - Bari
** Consorzio CALEF, S.S. 106 Ionica, km 419+500, 75026 Rotondella - Matera
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
607
R. Spina et al. - Saldatura ibrida laser-MIG di giunti a T in lega di titanio
1. Introduzione
Le industrie automobilistica, navale e aeronautica sono i settori industriali in cui l'adozione delle tecnologie innovative
di saldatura è fondamentale per la competitività dei loro prodotti. Molti altri settori stanno attualmente valutando queste
tecnologie come, ad esempio, il settore energetico e quello
edilizio-architettonico. Tra le tecniche di saldatura innovative, quella laser è sempre più presa in considerazione in
quanto le nuove sorgenti sono in continuo sviluppo e vengono introdotte sempre con maggiore frequenza sul mercato,
consentendo un maggiore grado di automazione e costi di
gestione più bassi. La sfida delle nuove tecnologie di giunzione è rivolta a sviluppare processi di saldatura così competitivi da sostituire le tecniche di giunzione convenzionali (ad
esempio la rivettatura).
Nel settore aeronautico, particolare attenzione è rivolta
anche al largo uso del titanio e delle sue leghe. I vantaggi
del titanio nelle applicazioni ingegneristiche sono ben noti,
come l’elevata resistenza meccanica, la buona resistenza
alla corrosione, il mantenimento delle prestazioni utili sino
a circa 600 °C, la densità di circa il 60% inferiore a quella
degli acciai e quasi il 60% superiore a quella delle leghe di
alluminio. L'alto rapporto “buy-to-fly” associato ai componenti in lega di titanio ottenuti per lavorazione meccanica,
in combinazione con le molte difficoltà di produzione ed i
problemi di disponibilità più recenti, ha portato ad una forte
spinta verso la fabbricazione di componenti in lega di titanio
saldati con processi “near-net-shape”. Tuttavia le potenzialità di queste leghe sono state fortemente limitate dalla natura
ciclica del mercato del settore aerospaziale, soggetto a cicli
di 4-5 anni di alti e bassi, che fortemente riduce le iniziative
atte a diminuire i costi di estrazione e trasformazione.
Le particolari proprietà delle leghe di titanio richiedono
inoltre tecnologie particolari per poter ottenere un elevato
rapporto costo-efficacia nella produzione dei componenti.
In questo lavoro è stata studiata l’applicazione della tecnologia ibrida laser-MIG nella giunzione di componenti in lega
Ti-6Al-4V. I giunti saldati sono stati ottenuti da lastre con
spessore di 5 mm per i giunti di testa e di 3 mm per i giunti a T. La qualità della saldatura è stata valutata attraverso
l’analisi delle morfologie e sulla base delle considerazioni
energetiche di giunzione.
La saldatura ibrida laser-MIG è un processo di saldatura dei
materiali metallici in cui si combina il fascio laser con la saldatura ad arco nello stesso bagno di fusione, come riportato
da Victor (2011, [1]). Il concetto di saldatura ibrida è stato
introdotto nel 1970 come "saldatura laser aumentata dall’arco" e al giorno d'oggi sta diventando molto interessante
quando bisogna unire piastre di spessori elevati o quando
possono essere utilizzate nuove sorgenti laser. Usualmente
per il processo ibrido laser-MIG sono impiegati i laser di
alta potenza in continuo, quali quelli a CO2 o quelli allo stato
solido Nd:YAG; tuttavia, grazie al continuo progresso delle
loro prestazioni, altre sorgenti allo stato solido quali fiber
608
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
laser, disk laser e diode laser, sono sempre più utilizzati.
Particolarmente interessante è la saldatura delle leghe di titanio. Queste leghe sono caratterizzate da elevate proprietà meccaniche ed elevata resistenza alla corrosione che le
rendono molto interessanti per le applicazioni aeronautiche,
aerospaziali e navali. Tuttavia, l’applicazione di queste leghe
è limitata dalle difficoltà connesse alle operazioni di taglio,
saldatura e trattamento termico, oltre che dall’alto costo delle leghe stesse. Ad esempio, una schermatura efficace del
bagno di saldatura è essenziale per evitare l’alta reattività
degli elementi alle alte temperature al contatto con l’atmosfera. Inoltre i processi di saldatura devono essere flessibili
in modo da poter realizzare le giunzioni delle leghe di titanio
con o senza filo d'apporto. La saldatura laser da sola è in grado di produrre giunzioni molto strette rispetto ad altre tecniche, con caratteristiche di resistenza meccanica dei giunti
saldati equivalenti e talvolta superiori a quelle del materiale
di base. Tuttavia, gli svantaggi, che limitano un più ampio
utilizzo di questo processo, sono la capacità insufficiente di
colmare il gap tra lembi da saldare e l’alta precisione di posizionamento richiesta. La combinazione della saldatura laser
con il processo MIG ha dimostrato di risolvere gli inconvenienti della sola saldatura laser, pur mantenendo i vantaggi
ed addirittura migliorando sia la velocità di saldatura che la
profondità di penetrazione.
2. Setup sperimentale e metodi di analisi
La descrizione della disposizione della stazione di saldatura
ibrida laser-MIG e delle sue relazioni geometriche principali è essenziale prima di poter definire la procedura sperimentale per realizzare le saldature. La sorgente principale è
costituita da una laser CO2 da 6 kW (El.En. C6000), accoppiato alla sorgente secondaria costituita da una macchina di
saldatura MIG (ESAB Aristo LUD 450W in combinazione
con l'unità spingi-filo MEK 4C). E’ stata adottata una disposizione in tandem delle due sorgenti in modo che ciascuna
fonte di energia operasse in modo indipendente, generando
un unico bagno di fusione. Il laser ha la funzione di creare
la passata principale che viene riempita dalla saldatura MIG,
realizzando la saldatura completa. I giunti di lega Ti-6Al-4V
che sono stati realizzati mediante saldatura ibrida laser-MIG
sono stati quelli in configurazione di testa, a partire da fogli
di dimensioni 175 x 175 x 5 mm3 ed in configurazione a T
da fogli di dimensioni 175 × 50 × 3 mm3. I lembi dei giunti
sono stati preparati mediante fresatura iniziale per garantire
un corretto accoppiamento, attaccati con acido per rimuovere le impurità ed il leggero strato di ossidazione ed infine
sgrassati e puliti prima della saldatura stessa. Due punti di
saldatura sono stati effettuati all'inizio e alla fine del giunto
per assicurare un leggero assemblaggio meccanico e ridurre di conseguenza il rischio di aumento del gap causato dal
disallineamento dei lembi durante il processo di saldatura.
Il materiale di apporto utilizzato è stato un filo di lega
Ti-6Al-4V di 1.14 mm di diametro, scelto per preservare le
R. Spina et al. - Saldatura ibrida laser-MIG di giunti a T in lega di titanio
Figura 1 - Configurazione della stazione ibrida laser-MIG
proprietà meccaniche del materiale base. Quali gas di copertura, si sono utilizzati elio per la soppressione del plasma e
per la protezione del bagno di fusione, facendolo flussare direttamente dalla torcia MIG ed argon che esce dalla scarpetta a rimorchio per evitare il contatto tra il bagno di saldatura
e l'atmosfera, generando allo stesso tempo un flusso diffuso
che acceleri la solidificazione stessa. La scelta del tipo di gas
di protezione è stata valutata molto attentamente perché questi gas influenzano l’interazione tra fascio laser e caratteristiche dell'arco. Si possono difatti ottenere elevate velocità di
saldatura se si utilizza elio al posto di argon, raggiungendo
nel contempo profondità di penetrazione maggiori.
Tuttavia, la stabilità dell'arco è più difficile da ottenere e la
tendenza alla formazione degli spruzzi è elevata, come ripor-
Figura 2 - Parametri di configurazione per il giunto a T
tato da Chae et al. (2008, [2]). La Figura 1 mostra la configurazione della stazione ibrida laser-MIG dal punto di vista del
piano XZ, insieme ai parametri geometrici della testa laser,
torcia MIG e scarpetta del gas di protezione. La direzione
della saldatura è coincidente con l'asse X positivo.
L'angolo D definisce l'inclinazione dell'asse centrale della
torcia MIG rispetto all'asse Z, asse a sua volta coincidente
con l'asse centrale della testa laser. Il parametro SO definisce
la distanza (stick-out) tra la punta di contatto della pistola
MIG e lo spigolo del pezzo. Ulteriori parametri per la saldatura a T sono riportati nella Figura 2, dal punto di vista
del piano YZ. Il giunto è posizionato con l'angoloE rispetto
all'asse del fascio laser e poi bloccato prima di iniziare il
processo di saldatura. Questa configurazione è stata indicata come 1F (saldatura ad
angolo, in posizione piatta)
per piastre/fogli secondo la
designazione degli standard
ANSI/AWS in funzione
dell’angolo iniziale tra laser
ed asse Z. La scelta della
posizione 1F è necessaria
quando si intende lasciare
che la gravità spinga il metallo fuso verso la parte inferiore del giunto, rendendo la
saldatura più facile e veloce.
La posizione di saldatura 2F
(saldatura ad angolo, in posizione orizzontale) infatti
risulta essere di più difficile
esecuzione, in quanto il metallo fuso tende a colare e/o
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
609
R. Spina et al. - Saldatura ibrida laser-MIG di giunti a T in lega di titanio
m/min. Ulteriori parametri costanti
sono stati lo stick-out SO (19 mm),
Nome
Abbreviazione Tipo
Intervallo
la durata del picco di corrente Tp
Potenza
PLaser
Variabile
1500-2500 W
(1.7 ms), la frequenza degli impulLaser
si F (276 Hz), la tensione V (40 V)
Posizione focale
FSP
Costante 0 mm
e la corrente di base Ib (48 A).
Tensione
V
Costante 40 V
La modalità sinergica del MIG è
Corrente di picco
Ip
Variabile
480 - 580 A
stata disattivata per consentire la
selezione del tempo di picco Tp.
Costante 48 A
Corrente di base
Ib
La corrente di picco Ip poteva invece
Tempo di picco
Tp
Costante 1.70 ms
assumere i valori di 480 e 580 A così
MIG
come la potenza del laser PLaser che
Tempo di base
Tb
Costante 1.92 ms
poteva variare tra 1500 e 2500 W.
Frequenza
F
Costante 276 Hz
Le portate dei gas di protezione
sono state di 50 Nl/min di elio e
Stick out
SO
Costante 16 mm
45 Nl/min di argon.
9HORFLWjGHOÀOR
SWire
Costante 5×103 mm/min
La saldatura del giunto a T ha
Velocità di saldatura
SWelding
Costante 2×103 mm/min
anch’essa previsto una riduzione
delle prove preliminari attraverso
Comuni
Costante 30-60 Nl/min
Portata di elio
QHe
l’esecuzione della saldatura dei lati
Portata di argon
QAr
Costante 20-60 Nl/min
sinistro e destro con parametri di
processo differenti. Al fine di eviPosizione del pezzo
Costante 1F
tare la possibile influenza termica
Inclinazione del pezzo E
Costante 45 degree
tra le due passate di saldatura, si è
atteso un tempo sufficientemente
&RQÀJXUD]LRQH Laser\MIG offset
LGO
Costante 0 mm
lungo, necessario a riportare alla
Laser\MIG angolo
Costante 48 degree
D
temperatura ambiente il giunto
in tutte le regioni dopo la prima
Laser\spigolo offset
LCO
Variabile
0-1 mm
passata. I parametri di processo
esaminati in questa configurazioscorrere sulla piastra orizzontale e, per tale motivo, non è
ne sono legati alla sorgente laser, a quella MIG ed alla loro
stata utilizzata durante le prove sperimentali. Il parametro
interazione. I parametri di processo con il loro intervallo di
variazione sono riportati nella Tabella 1.
LCO definisce l'offset dello spot del fascio laser dallo spigoLa gamma di variazioni dei parametri di processo sono stati
lo del pezzo, misurato lungo l'asse ausiliario W.
direttamente ottenuti da studi precedenti degli stessi autori
Lo spot del fascio laser è stato sempre focalizzato sulla trasu giunti di testa Ti-6Al-4V saldati con sistema ibrido laserversa del pezzo, indipendentemente dal valore LCO.
MIG, come Brandizzi et al. (2011, [4]).
Si ricordi che la giusta individuazione delle opportune comIn questa operazione preliminare, la valutazione della qualibinazioni dei parametri di saldatura che accoppiino in modo
tà delle superfici di saldatura è stata eseguita mediante semsinergico ed efficiente il MIG pulsato con il fascio laser riplice ispezione visiva per rilevare i difetti superficiali, gli
chiede tempo, ed è il risultato talvolta di un numero molto
insufficienti riempimenti e gli spruzzi. Successivamente, le
elevato di prove eseguite non sempre in modo sistematico,
saldature a T sui due lati si sono eseguite con gli stessi paracome riportato da Subramanian et al. (1999, [3]).
metri di processo.
Per questo motivo, l'attività sperimentale ha previsto una
prima fase preparatoria di studio dei parametri di processo
3. Analisi dei campioni rifusi e dei giunti di testa
finalizzata al miglioramento della conoscenza sul processo
ibrido laser-MIG per le leghe di titanio, eseguendo inizialmente la saldatura di giunti di testa ed in seguito applicando
I campioni ottenuti con le prove preliminari di penetrazione,
i risultati ottenuti alla configurazione del giunto a T.
utilizzando la sola sorgente laser, presentano evidenti inciLa saldatura di testa è stata effettuata con l’obiettivo di vesioni marginali, sia in superficie che alla radice della saldarificare la condizione di lavoro del sistema ibrido laser-MIG
tura, che possono determinare la concentrazione delle sollee quindi di analizzare gli effetti sul processo di saldatura di
citazioni durante il funzionamento in esercizio del giunto e
ulteriori parametri e della configurazione a T. Per ridurre
rappresentano cause potenziali di rottura per la formazione
il numero di campioni da eseguire, le prove di rifusione si
di cricche. Le prove preliminari di penetrazione, tramite il
sono effettuate mantenendo la velocità di saldatura SWelding
sistema ibrido laser-MIG, hanno invece permesso di ottenere un cordone più uniforme e stabile in superficie.
costante e pari a 2.0 m/min ed la velocità del filo SWire a 4.0
TABELLA 1 - Parametri di processo
610
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
R. Spina et al. - Saldatura ibrida laser-MIG di giunti a T in lega di titanio
La diminuzione della distanza tra sorgente laser e posizione
del filo della torcia (distanza laser–MIG) non ha avuto particolare influenza sulla geometria del cordone. Tuttavia la
sua riduzione ha permesso di ottenere un infittimento delle
gocce e la diminuzione delle incisioni marginali alla radice.
I risultati delle prove di rifusione (vista superiore e sezione
trasversale del cordone) sono riportati nella Figura 3, dove
si evidenzia che l’aumento della potenza laser da 1750 a
2250 W determina un aumento dell’altezza e della larghezza
del cordone di saldatura così come dell’area fusa. Anche la
profondità di penetrazione (altezza meno sormonto in testa)
aumenta con l’aumentare della potenza in quanto il valore
del sormonto in testa rimane pressoché costante e pari a 0.81
mm. L’aumento del sola intensità di corrente Ip al valore di
580 A, come riportato nella Figura 4, determina un aumento
dell’altezza del cordone di saldatura a scapito della larghezza. L’area fusa tende sostanzialmente a rimanere costante.
La potenza laser impostata è però più elevata, variando tra
2000 e 2500 W. Questa maggiore potenza laser, accoppiata
alla potenza MIG disponibile, fornisce più energia che tende ad andare in profondità nel giunto. Questo è evidenziato
dalla presenza dei sormonti a radice che iniziano a diventare
più evidenti, raggiungendo valori di 0.19 mm.
I valori del sormonto in testa rimangono pressoché costanti.
Tuttavia, questa condizione causa una forte instabilità del
bagno fuso alla potenza laser più elevata, come evidenziato
dalla presenza di spruzzi in quantità ed in dimensioni non
trascurabili. Dall’analisi dei risultati ottenuti dalla prove di
rifusione, appare evidente che la maggiore potenza MIG è
consigliabile per aumentare la profondità di penetrazione,
sino a che la potenza laser non diventa troppo alta. In caso
contrario la qualità della saldatura peggiora. Questo dato
viene inoltre confermato dalle interessanti considerazioni
che scaturiscono dall’analisi della potenza totale di saldatura, come risultato dell’interazione tra il fascio laser e l’arco
MIG. La Figura 5 riporta i grafici delle potenze laser e MIG
rilevate nelle prove di penetrazione con intensità di corrente
Ip di 480 A. La potenza totale è la somma della potenza laser
e della potenza MIG, entrambe rilevate. Si evidenzia come
l’aumento di potenza laser impostata determini un aumento
della potenza totale rilevata, come ci si aspetterebbe.
Tuttavia, se si analizza il dato dal punto di vista del contributo percentuale della potenza laser rilevata sulla potenza totale si nota che al di sopra del valore di 2000 W il contributo
della potenza laser diminuisce, evidenziando un maggiore
contributo della potenza MIG rilevata.
Figura 3 - Prove di rifusione con Ip = 480 A
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
611
R. Spina et al. - Saldatura ibrida laser-MIG di giunti a T in lega di titanio
Figura 4 - Prove di rifusione con Ip = 580 A
Figura 5 - Potenza totale e MIG rilevate con Ip = 480 A
612
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
Figura 6 - Potenza totale e MIG rilevate con Ip = 580 A
R. Spina et al. - Saldatura ibrida laser-MIG di giunti a T in lega di titanio
7, dove sono presenti tre sezioni estratte dal cordone di saldatura per verificare la stabilità del processo. Si può notare
come la saldatura risulti eccellente con assenza di schizzi
ed incisioni marginali, a conferma della bontà dei parametri
ottenuti nelle prove di rifusione. Il processo è inoltre molto
stabile, visto che la larghezza e l’altezza del cordone hanno
una bassa variabilità così come l’area fusa. I risultati sono
concordi con quelli ottenuti dalle prove di rifusione, con un
certo incremento della profondità a scapito della larghezza
del cordone.
4. Analisi dei giunti a T
Figura 7 - Saldatura di testa con PLaser di 2250 W e Ip = 580 A
La variazione di potenza laser quindi influenza la potenza
MIG fornita effettivamente al giunto, anche se i parametri
impostati al sistema MIG sono costanti. Il dato si inverte
nel caso di prove di penetrazione con intensità di corrente Ip
di 580 A, come evidenziato dalla Figura 6. In questo caso,
l’aumento di potenza laser impostata causa l’incremento di
potenza MIG rilevata sino al valore di 2250 W. Dopo questo
valore, l’aumento della potenza laser provoca una diminuzione della potenza MIG fornita al giunto, a favore del contributo percentuale del fascio laser. Inoltre la potenza totale
rilevata si riduce. Partendo dai risultati delle prove di rifusione, si è proceduto ad effettuare le prove di saldatura di testa.
I parametri utilizzati sono stati quelli relativi all’intensità di
corrente Ip di 580 A e potenza laser pari a 2250 W. I risultati
della saldatura di testa realizzati sono riportati nella Figura
I giunti realizzati durante l'attività sperimentale sono stati
tutti sottoposti a controllo visivo prima di procedere ad ulteriori misurazioni. Il controllo visivo ha avuto luogo prima, durante e dopo la saldatura. I giunti che hanno mostrato
evidenti difetti superficiali e geometrici non sono stati sottoposti all’analisi morfologica. Per poter estendere l’analisi
dei giunti di testa ai giunti a T, è stato necessario valutare
alcuni parametri introdotti dalla particolare configurazione
del giunto quale l’angolo di inclinazioneE per la configurazione 1F e la distanza LCO tra lo spot laser e lo spigolo del
giunto. I parametri di processo utilizzati sono stati gli stessi
di quelli ottenuti per la saldatura di testa. Una più dettagliata
trattazione di come i parametri di processo mantenuti costanti siano stati scelti è stata fatta da Spina et al. (2012, [5]).
L’angolo di inclinazione E è stato variato tra 45° e 60°.
Questo parametro influenza direttamente la morfologia e
le dimensioni del cordone di saldatura. La Figura 8 mostra
l'aspetto di saldatura e le relative macrografie nelle configurazioni con i due valori dell’angolo. I risultati riportati nella
stessa figura evidenziano che l'aumento dell’angolo E ha avuto limitati effetti sull’area fusa e sulla larghezza del cordone
mentre è risultata più importante l’influenza sulla profondità
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
613
R. Spina et al. - Saldatura ibrida laser-MIG di giunti a T in lega di titanio
Figura 8 - Saldatura a T con E variabile
Figura 9 - Saldatura a T con LCO variabile
614
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
R. Spina et al. - Saldatura ibrida laser-MIG di giunti a T in lega di titanio
Figura 10 - Saldatura a T con PLaser variabile
di penetrazione, che aumenta con l’aumentare dell’angolo.
Sulla base di questi risultati, la successiva sperimentazione è
stata condotta conE di 60°. La distanza laser\spigolo LCO è
stata variata tra 0 e 1 mm. La Figura 9 mostra l'aspetto della
saldatura e le relative macrografie nelle configurazioni con
i due valori di distanza. L'effetto del parametro LCO sulla
morfologia della saldatura è riportato nella stessa figura, in
cui si nota l’incremento dell’area fusa ed il leggero aumento
della larghezza e dell’altezza di penetrazione. Si noti inoltre
come larghezza ed altezza tendono ad avere quasi lo stesso
valore, evidenziando una trasferimento del calore uniforme
lungo le direzioni longitudinale e perpendicolare all’asse di
saldatura. Questo aumento di area fusa a parità di larghezza
e lunghezza del cordone è stato giustificato, ipotizzando la
riduzione del calore trasmesso per conduzione con l’allontanamento dallo spigolo. Per questo motivo, la distanza LCO
è stata fissata a 1 mm.
Una volta individuati i valori di questi parametri, tipici della
configurazione del giunto a T, si è proceduto alla sperimentazione con i parametri individuati dalle prove sulle saldature di testa. La potenza laser è stata variata tra 1500 e 2250 W,
mantenendo fisso il valore di intensità di corrente IP a 580 A.
La Figura 10 mostra le macrografie delle sezioni saldate,
realizzate con diversi valori della potenza laser ed i risultati delle misure dei principali parametri. La diminuzione
della potenza del laser da 2000 W a 1750 W ha causato,
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
615
R. Spina et al. - Saldatura ibrida laser-MIG di giunti a T in lega di titanio
totale che della potenza MIG. Il fenomeno è quindi lo stesso
di quello rilevato per le saldature di testa e riportato nella
Figura 6, anche se i livelli di potenza totale sono leggermente più bassi e il fenomeno si attiva a livelli di potenza laser
più alta.
5. Conclusioni
Figura 11 - Potenza totale e MIG rilevate con Ip = 580 A
come previsto, la diminuzione della altezza e dell’area fusa,
mentre la larghezza di saldatura rimane pressoché costante.
L’ulteriore riduzione di potenza laser non ha avuto grandi
influenze. Pertanto si è deciso di adottare i valori di potenza
da 2000 W in su, che garantiscono la maggiore profondità di
penetrazione. Anche per il processo di saldatura del giunto
a T si è effettuata una analisi della potenza totale, come evidenziato dalla Figura 11. La potenza MIG cresce continuamente sino a quando il valore di potenza laser imposta è di
2000 W, rimanendo stabile dopo questo valore, nonostante
l’incremento della potenza laser. La potenza totale continua
ad aumentare con quella laser, sino a raggiungere il valore
massimo di 11000 W, ottenuto per un valore di potenza laser
imposta di 2500 W. Un ulteriore incremento della potenza
laser al valore di 2750 W causa la riduzione sia della potenza
616
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
Il processo di saldatura ibrido laser-MIG applicato alle leghe
di titanio ha rivelato una grande stabilità, ripetibilità e continuità nelle prestazioni fornite. Il percorso seguito durante la
sperimentazione ha evidenziato che, partendo dalle prove di
rifusione, è possibile identificare i parametri di processo più
adatti per la realizzazione delle prove di saldatura di testa
ed in seguito per i giunti a T. I giunti realizzati hanno messo
in evidenza un cordone caratterizzato da assenza di porosità e di incisioni marginali. Nel caso dei giunti di testa, si è
riusciti ad ottenere la completa penetrazione su lamiere di 5
mm di spessore, mentre nei giunti a T si si sono ottenuti la
buona sovrapposizione delle passate di saldatura per lamiere
di spessore di 3 mm. Dal punto di vista energetico, si evidenzia la convenienza di operare con alte energie sia del fascio
laser che della sorgente MIG, ma senza raggiungere livelli
di potenza totale imposta troppo elevati. In caso contrario si
instaura nel bagno di saldatura una forte instabilità che, dal
punto di vista estetico, determina l'eccessiva formazione degli spruzzi mentre, dal punto di vista energetico, causa la riduzione della potenza registrata all’aumentare della potenza
imposta. Questo fenomeno mette in evidenza che la potenza
laser e la potenza MIG nel sistema ibrido non si sommano
ma operano in modo sinergico entro certi limiti, superati i
quali le due sorgenti si disturbano a vicenda.
Questo fenomeno merita ulteriori approfondimenti.
Ringraziamenti
Questo lavoro è stato parzialmente finanziato dal MIUR
(Progetto MAC – Nuove metodologie di processo e materiali avanzati per la cantieristica da diporto) e dalla Regione
Puglia (TRASFORMA). Gli autori desiderano ringraziare
Roberto De Bonis (Consorzio CALEF) and Enzo Putignano
(Consorzio CALEF) per il loro prezioso contributo durante
l’attività sperimentale.
R. Spina et al. - Saldatura ibrida laser-MIG di giunti a T in lega di titanio
%ibliograÀa
[1]
[2]
[3]
[4]
[5]
Victor B.M., [Hybrid Laser Arc Welding], ASM Handbook, Volume 6A, Welding Fundamentals and Processes,
321-328 (2011).
Chae H.-B., Kim C.-H., Kim J.-H., Rhee S., “The effect of shielding gas composition in CO2 laser - gas metal arc
hybrid welding”, J. of Engineering Manufacture, 1315-1324 (2008).
Subramanian S., White D. R., Jones J. E. and Lyons D. W., “Experimental Approach to Selection of Pulsing Parameters in Pulsed GMAW”, Welding Journal, 166-172 (1999).
Brandizzi M., Satriano A. A., Tricarico L., “CO2 laser - MIG hybrid welding of titanum alloy”, Advanced Materials Research, 264-265:1270-1280 (2011).
Spina R., Sorgente D., Palumbo G., Scintilla L. D., Brandizzi M., Satriano A. A., Tricarico L., “T-joints of Ti
alloys with hybrid laser-MIG welding: Macro-graphic and micro-hardness analyses”, Proceedings of SPIE - The
International Society for Optical Engineering, 8239 , art. no. 82390C (2012).
Roberto SPINA, Professore Associato confermato in “Tecnologia e Sistemi di Lavorazione” presso il Politecnico di
Bari dal Settembre 1999. Svolge le sue attività di ricerca nel settore delle tecnologie e dei sistemi di produzione fin
dal 1996.
Durante le sue attività di ricerca, ha pubblicato più di 70 memorie in riviste nazionali ed internazionali con referee,
libri e conferenze. Le sua attività di ricerca si concentra sulle tematiche relative alle tecnologie di trasformazione dei
materiali polimerici, stampaggio ad iniezione di termoplastici, lavorazioni laser, ottimizzazione e pianificazione dei
sistemi di produzione.
Donato SORGENTE, Ricercatore Universitario in “Tecnologie e Sistemi di Lavorazione” presso il Politecnico di Bari.
Consegue, nel Marzo 2007, il titolo di Dottore di Ricerca in “Sistemi Avanzati di Produzione”. Lavora, fino ad Ottobre
2007, presso i laboratori del Dipartimento di Ingegneria Meccanica e Gestionale del Politecnico di Bari, come titolare
di contratti di collaborazione. Da Ottobre 2007 a Marzo 2008 lavora presso la sede di Valenzano (BA) del Centro
Ricerche FIAT, svolgendo attività inserite nella business line “Advanced Manufacturing & Materials”.
Da Marzo 2008 ad oggi svolge attività di ricerca presso il Politecnico di Bari nell’ambito di progetti di ricerca
cofinanziati da enti pubblici ed aziende private.
Le attività di ricerca si sono principalmente focalizzate sull’ottimizzazione dei processi produttivi con particolare
attenzione alle lavorazioni dei materiali metallici.
Luigi TRICARICO, Professore ordinario in “Tecnologie e Sistemi di Lavorazione”. In servizio presso il Politecnico
di Bari, dove svolge attività didattica e di ricerca nell’ambito delle tecnologie meccaniche. Autore, dal 1984
ad oggi, di oltre 100 lavori scientifici pubblicati in sede nazionale ed internazionale, in settori di ricerca vicini
alla caratterizzazione meccanica e tecnologica dei materiali e alle lavorazioni non convenzionali. Attualmente
è responsabile di progetti di ricerca sulla progettazione e ottimizzazione con tecniche numeriche sperimentali di
tecnologie di formatura in campo plastico e superplastico, di lavorazioni di taglio e saldatura con fascio laser, di
materiali avanzati e tecnologie innovative.
Marco BRANDIZZI, Direttore del Consorzio CALEF. Laureato in Ingegneria Meccanica nel 1989, è stato
sperimentatore presso RTM (1989) e ricercatore presso il CRF (1990) nel campo delle applicazioni laser.
Nel 1993 è stato responsabile del Centro Laser del CRF, conducendo anche corsi di formazione sulle tecnologie laser
e dal 1994 è responsabile di progetti per lo sviluppo e l’applicazione di tecnologie innovative nelle aree di meccanica,
carrozzeria e componentistica automotive.
Dal 1998 è stato coordinatore e responsabile CRF e CALEF di numerosi progetti nazionali ed europei in vari settori
industriali (automobilistico, aeronautico e navale). Autore di oltre 20 lavori scientifici e relatore industriale di oltre
40 tesi di laurea.
Annunziata Anna SATRIANO, laureata in Ingegneria Meccanica presso il Politecnico di Bari con tesi di laurea in
tecnologie speciali dal titolo “Approccio numerico sperimentale per la caratterizzazione delle lamiere saldate al fascio
laser” nel 1998. Nel 1999 stage in attività sperimentale sulle tecnologie laser e sullo sviluppo componenti iniezione
presso il Centro Ricerche Fiat. Da fine 1999 dipendente CRF Powertrain Research & Technology, dal 2008 dipendente
ELASIS Manufacturing & Processes, distaccata presso il Consorzio CALEF, dove ha svolto attività di ricerca sulle
tecnologie laser. E’ coinventore europeo con 14 brevetti nel settore automotive di cui alcuni estesi anche in altri
paesi. Relatrice industriale di alcune tesi di laurea in tecnologie speciali. Attualmente è dipendente di Fiat Group
Automobiles S.p.A. - Manufacturing Engineering, nella sede di Pomigliano d’Arco (NA).
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
617
TECNOLOGIE PER L’INNOVAZIONE
MECSPE
EUROSTAMPI
PLASTIXEXPO
TRATTAMENTI & FINITURE
SUBFORNITURA
MOTEK ITALY
CONTROL ITALY
LOGISTICA
Recenti sviluppi della RBI - Risk Based
Inspection dell’American Petroleum
Institute: l’integrazione con la tecnologia
del Fitness For Service per il calcolo
della probabilità di rilascio
S. Pinca *
1. Introduzione
Nel campo della gestione degli impianti di processo, la tecnologia della programmazione delle
verifiche ispettive delle attrezzature in pressione, basata sul rischio (RBI – Risk Based Inspection) è di fatto una “buona prassi” consolidata o
meglio, in considerazione della sua diffusione
globale, una “Best Practice” che trova credito
anche presso gli organismi di controllo [1].
La tecnologia sviluppata dall’American Petroleum Institute (API) e procedurata nelle pratiche raccomandate API RP 580 [2] e API RP 581
[3], è considerata lo standard non soltanto per
processi di raffinazione del petrolio, ma anche
per impianti del settore petrolchimico e chimico. Il successo e la considerazione di cui gode la
tecnologia API-RBI è senza dubbio conseguente alle modalità con cui l’Istituto normatore
americano ha sviluppato il progetto e gestito le
implementazioni della procedura, mediante un
processo di rinnovamento continuo.
*
Sommario / Summary
La tecnologia RBI (Risk Based Inspection) dell’American Petroleum
Institute è uno strumento di gestione sottoposto ad un continuo processo di rinnovamento e sviluppo. Nell’articolo è esposta l’ultima proposta di revisione della valutazione della probabilità di rilascio che integra le procedure di calcolo sviluppate nell’ambito delle valutazioni
affidabilistiche del Fitness For Service.
The Risk Based Inspection Technology worked out by the American
Petroleum Institute is a management tool subjected to a continuous
process of renewal and development. This article exposes the latest
proposed revision of the likelihood of failure assessment that integrates the calculation procedures developed in the context of reliability
assessments as Fitness For Service.
IIW Thesaurus Keywords:
API; corrosion; development; fitness for purpose; mathematical models; risk evaluation; risk-based inspection; statistical methods.
IIS SERVICE dell’Istituto Italiano della Saldatura, Genova
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
619
S. Pinca - Recenti sviluppi della RBI - Risk Based Inspection dell’American Petroleum Institute: l’integrazione con la tecnologia del FFS...
2. Il “background” della tecnologia API-RBI
La tecnologia della Risk Based Inspection dell’API nasce
nel 1994 come progetto di ricerca industriale (JIP – Joint
Industrial Project), sponsorizzato da 16 società o compagnie
petrolifere americane, coordinato dall’Istituto americano,
garante della sua pubblica divulgazione. Il progetto ha lo
scopo di definire una procedura che utilizza la valutazione
del rischio quale criterio per la definizione delle priorità degli interventi di ispezione e verifica dello stato di conservazione delle attrezzature a pressione, nell’ottica del mantenimento di un adeguato livello di sicurezza e dell’ottimizzazione delle risorse per l’ispezione e per la manutenzione
degli strumenti di produzione (impianti). È del maggio 1996
la pubblicazione del primo documento [4], in forma di procedura operativa, per il calcolo del rischio e per la definizione del piano di ispezione che, prima di completare l’iter di
approvazione formale conclusosi nel 2000 [5], è stato sottoposto per un periodo quadriennale ad una fase di applicazioni sperimentali. La constatazione che la pubblicazione della
procedura operativa precede il documento API RP 580 [6],
relativo ai principi, agli indirizzi ed ai requisiti dell’analisi
RBI, è in qualche modo rivelatore dell’approccio empirico
che gli americani hanno dato al progetto. Sin dalle prime
applicazioni è stata evidenziata la necessità di disporre di
un adeguato strumento informatico dedicato (software) per
l’esecuzione delle valutazioni, non solo per la complessità
degli algoritmi di calcolo, ma anche per l’estensione in termini di numero di attrezzature in pressione, che un’applicazione industriale comporta. L’impostazione del progetto
prevede un processo di aggiornamento continuo della procedura attraverso la condivisione delle esperienze applicative del gruppo degli utilizzatori (di cui il Gruppo Istituto
Italiano della Saldatura è membro dal 2001) e degli sviluppi
tecnologici delle discipline correlate, che determina l’emissione ciclica di nuove edizioni del documento API RP 581
[3], [4], [5].
3. Gli sviluppi futuri
Una delle implementazioni che troverà compimento nella prossima edizione della procedura RP 581, è costituita
dall’introduzione, nel calcolo della probabilità di rilascio
per danneggiamenti da corrosione localizzata, della formulazione del fattore di resistenza residua o RSF (Remaining
Strength Factor) sviluppato dalle valutazioni FFS – Fitness
For Service [6], con trattazione stocastica delle variabili di
governo. Nel seguito si cercherà di illustrare la metodologia di calcolo che ha portato alla proposta di revisione degli
algoritmi semplificati della procedura API RP 581. La discussione dei dettagli tecnici e la dimostrazione di tali algoritmi sarà documentata da una pubblicazione del Welding
Research Council di prossima emissione [7], che costituirà il
supporto tecnico della stessa nuova procedura API RP 581.
620
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
4. DeÀnizione della probabilità di rilascio e del
fattore di danno per corrosione
In accordo al documento API RP 581 del 2008 [3], la probabilità di rilascio Pf(t) è definita mediante la seguente semplice formulazione:
Pf (t) = gff . Df (t) . FMS
Dove:
gff frequenza generica del rilascio [eventi/anno];
Df fattore adimensionale di danno;
FMS fattore adimensionale di valutazione del sistema di gestione.
Un database di frequenze generiche di accadimento è fornito dal documento API 581 con valori variabili, in ordine
di grandezza, tra 10-4 e 10-5 eventi/anno, differenziati per tipologia di componente e scenario di rilascio (dal rilascio da
piccola perdita assimilabile ad un foro di diametro pari a ¼”,
sino al collasso dell’intero componente). Il fattore di danno
per meccanismo di corrosione, è dato anch’esso in forma tabellare in funzione della percentuale stimata di perdita dello
spessore di parete (Rateo di corrosione x Tempo / Spessore).
I valori del fattore di danno sono stati derivati da una elaborazione numerica sviluppata secondo i seguenti punti:
r definizione di un modello di danneggiamento che descriva lo stato limite per assottigliamento della parete di
contenimento del recipiente;
r descrizione statistica delle variabili in ingresso;
r definizione del metodo di aggiornamento della conoscenza dello stato del danneggimento attraverso interventi di ispezione diretta, mediante l’applicazione del
teorema di Bayes;
r determinazione della probabilità di rilascio;
r calcolo del fattore di danno in relazione alle frequenze
generiche di accadimento considerate.
Tale impostazione metodologica, sviluppata per la stesura
dell’attuale edizione del documento API RP 581, è stata utilizzata per la proposta di revisione del calcolo della probabilità del rilascio, variando le assunzioni e le scelte operate
su ogni punto.
5. Modello di danneggiamento e funzione di stato
limite
La funzione di stato limite per un recipiente soggetto a collasso indotto da meccanismi di corrosione (assottigliamento
della parete di contenimento) è definibile nella seguente formulazione:
G(t) = R(t) - L
Dove:
L è il carico (pressione);
R(t) è la resistenza.
S. Pinca - Recenti sviluppi della RBI - Risk Based Inspection dell’American Petroleum Institute: l’integrazione con la tecnologia del FFS...
Il modello di danneggiamento adottato per l’attuale edizione API RP 581 è descritto mediante una funzione di stato
limite al colasso plastico per recipienti cilindrici di piccolo
spessore:
Dove:
Sf
'W(t)
Winit
OD
P
è la tensione di collasso plastico;
è la perdita di spessore all’istante t;
è lo spessore iniziale;
è il diametro esterno;
è la pressione.
L’assunzione di tale modello mostra evidenti limiti di rappresentatività per le geometrie diverse da quella cilindrica,
o per recipienti di elevato spessore, o per fenomeni di corrosione localizzata.
Pertanto i miglioramenti proposti con la nuova procedura
consistono nell’adozione delle funzioni di stato limite con
riferimento al fattore di resistenza residua (RSF – Remaining Strengh Factor) definito nelle procedure FFS (Fitness
for Service) per la modellazione di corrosioni localizzate e
pitting in accordo al documento API 579-1/ASME FFS-1
[6] dove il termine relativo ai carichi (L) è posto pari alla
pressione, mentre il termine relativo alla resistenza è definito
mediante le seguenti formulazioni:
Per geometria cilindrica
Per geometria sferica
Dove:
Dove:
Vys
Vuts
R0init
Winit
Ciej
Coek
t
'tji
'tko
è la tensione di snervamento;
è la tensione ultima a rottura;
è il diametro esterno iniziale;
è lo spessore di parete iniziale o all’inizio del periodo
di valutazione;
è il j-esimo rateo equivalente di corrosione interna;
è il k-esimo rateo equivalente di corrosione esterna;
è il tempo della valutazione;
è il j-esimo incremento temporale corrispondente a:
Ciej , 6j 'tji = t;
è il k-esimo incremento temporale corrispondente a:
Coek , 6k 'tko = t;
e dove il fattore di resistenza residua è così formulato:
in cui RLT è il fattore di spessore rimanente, funzione della perdita di spessore per corrosione nelle aree circostanti
la corrosione localizzata ed Mt è il fattore di Folias basato
sull’estensione longitudinale della corrosione localizzata,
anch’esso dipendente dal tempo.
Per la formulazione di tali parametri si rimanda al documento API 579-1/ASME FFS-1 [6].
6. Distribuzione statistica delle variabili
indipendenti
In relazione alla trattazione stocastica del problema, le variabili di governo sono suddivise in quattro raggruppamenti e
per ognuna è raccomandata una distribuzione di probabilità
come riportato nella Tabella 1.
Rispetto all’impostazione del documento RP 581 del 2008,
nella nuova procedura anche le caratteristiche geometriche del componente sono considerate variabili aleatorie ed
inoltre nuove variabili sono introdotte per la descrizione del
meccanismo di danno per corrosione localizzata.
7. L’aggiornamento del rateo di danneggiamento
mediante il teorema di Bayes
Per acciai ferritici
Per acciai austenitici
Il principio fondante la tecnologia RBI per cui l’esecuzione
di interventi di ispezione mediante misurazioni e tecniche di
controllo non distruttivo costituisce l’azione di mitigazione
della probabilità e quindi del rischio, è il risultato dell’applicazione del teorema di Bayes della probabilità delle cause.
Nel caso della valutazione del danneggiamento per corrosione, il rateo di corrosione è aggiornato in base alla conoscenza acquisita mediate periodiche ispezioni utilizzando il
Teorema di Bayes nel continuo.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
621
S. Pinca - Recenti sviluppi della RBI - Risk Based Inspection dell’American Petroleum Institute: l’integrazione con la tecnologia del FFS...
TABELLA 1 - Caratterizzazione statistica delle variabili indipendenti
Caratteristiche meccaniche del materiale
Tensione di snervamento Vys
Materiale
Valore nominale
Media
&RHIÀFLHQWHGL
variazione (COV)
Distribuzione
$FFLDLRDOFDUERQLR
Snervamento (ys)
1.13 ys
0.08
Lognormale
$FFLDLRLQRVVLGDELOHDXVWHQLWLFR
Snervamento (ys)
12.6 ys
0.15
Lognormale
Tensione ultima a rottura Vuts
Materiale
Valore nominale
Media
COV
Distribuzione
$FFLDLRDOFDUERQLR
Rottura (UTS)
1.15 UTS
0.06
Lognormale
$FFLDLRLQRVVLGDELOHDXVWHQLWLFR
Rottura (UTS)
1.13 UTS
0.06
Lognormale
Dimensione
Media
COV
Distribuzione
Diametro esterno iniziale R0init
Valore
nominale
0.05
Lognormale
Spessore iniziale di parete Winit
Valore
nominale
0.05
Lognormale
Geometria del componente
Meccanismo di danno (corrosione)
5DWHRGLFRUURVLRQH
Distribuzione
5DWHRGLFRUURVLRQHLQWHUQDJHQHUDOL]]DWD
equivalente Cie
La distribuzione può essere ottenuta mediante aggiornamento
bayesiano. La distribuzione a priori o marginale può essere
assunta Lognormale o Beta, in assenza di dati.
5DWHRGLFRUURVLRQHHVWHUQDJHQHUDOL]]DWD
equivalente Coe
La distribuzione può essere ottenuta mediante aggiornamento
bayesiano. La distribuzione a priori o marginale può essere
assunta Lognormale o Beta, in assenza di dati.
5DWHRGLFRUURVLRQHORFDOL]]DWDHTXLYDOHQWHLQ
profondità CLTnmax
La distribuzione può essere ottenuta mediante aggiornamento
bayesiano. La distribuzione a priori o marginale può essere
assunta di Tipo II o Beta, in assenza di dati..
5DWHRGLFRUURVLRQHORFDOL]]DWDHTXLYDOHQWHLQ
lunghezza CLTnlength
La distribuzione può essere ottenuta mediante aggiornamento
bayesiano. La distribuzione a priori o marginale può essere
assunta Lognormale o Beta, in assenza di dati.
Storia operativa
&DULFKLDSSOLFDWL
622
Distribuzione
Pressione L
Ë UDFFRPDQGDWD XQD GLVWULEX]LRQH Lognormale per la massima
SUHVVLRQHDQQXDOHFRQPHGLDSDULDOYDORUHGLSURJHWWRH
COV = 0.05.
7HPSHUDWXUDGLHVHUFL]LR
Ë WUDWWDWD FRPH XQD FRVWDQWH 1RQ DSSDUH HVSOLFLWDPHQWH QHOOD
IXQ]LRQH GL VWDWR OLPLWH WXWWDYLD LO VXR UXROR VL ULÁHWWH VXOOH
FDUDWWHULVWLFKH PHFFDQLFKH GHO PDWHULDOH H VXO PHFFDQLVPR GL
FRUURVLRQH1HLFDVLLQFXLLOYDORUHGHOODWHPSHUDWXUDVLGLVFRVWD
GDOOD FRQGL]LRQH DPELHQWH OH FDUDWWHULVWLFKH PHFFDQLFKH HG L
UDWHLGLFRUURVLRQHSRVVRQRHVVHUHFRUUHWWLPHGLDQWHXQIDWWRUH
PROWLSOLFDWLYRIXQ]LRQHGHOODWHPSHUDWXUD
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
S. Pinca - Recenti sviluppi della RBI - Risk Based Inspection dell’American Petroleum Institute: l’integrazione con la tecnologia del FFS...
Possono essere distinti tre componenti coinvolti nel processo:
r
r
r
La conoscenza a priori del rateo di corrosione, basata su
valutazioni di esperienza.
L’efficacia dell’ispezione intesa quale misura dell’abilità di rilevare il danneggiamento ricercato e definita in
base ad un modello matematico dell’accuratezza della
misura dello spessore, dal quale è stata derivata la probabilità condizionata della misura della perdita di spessore rispetto al reale rateo di corrosione.
I dati delle ispezioni, espressi in termine di misura della perdita di spessore riferita ad un certo periodo di
esercizio.
Sebbene la base teorica per la definizione degli algoritmi di
calcolo della procedura di calcolo dell’edizione 2008 sia la
medesima, nella nuova proposta il metodo discreto, riferito
a 3 possibili casi, è sostituito dalla trattazione in continuo
mediante le funzioni di distribuzione, attraverso la seguente
formulazione bayesiana:
8. Determinazione della probabilità di rottura
La probabilità di rottura o meglio di perdita di integrità della
parete di contenimento per effetto della corrosione, è definita come la probabilità che la funzione di stato limite sia
inferiore al valore 0, ovvero:
Pf(t) = P(G(t) < 0) = P(R(t) < L)
Nella nuova impostazione tale probabilità non è più la probabilità condizionata ad un determinato stato di danno, derivante appunto dall’applicazione del metodo discreto, riferito
a 3 possibili casi, ma la probabilità riferita a tutti i possibili
stati di danno (metodo continuo).
Per l’impossibilità di raggiungere la soluzione del problema
per via analitica, si è fatto ricorso al metodo affidabilistico
del primo ordine (FORM – First Order Reliability Method)
oppure alla simulazione mediante la “sempreverde” tecnica
Montecarlo.
9. Calcolo del fattore di danno
Volendo quindi ricondursi alla medesima formulazione per
le valutazioni RBI illustrata al Paragrafo 4, il fattore di danno per corrosione è stato dedotto mediante la seguente relazione:
La finalità di quest’ultimo passaggio risiede nella volontà di
produrre una procedura operativa sufficientemente semplice per un utilizzatore medio della tecnologia RBI, abituato
alla definzione dei fattori di danno mediante consultazione
su tabelle.
Pertanto nella nuova edizione del documento RP 581 sarà
presentato un set di tabelle per la definizione del fattore di
danno per corrosione in funzione di quel gruppo di parametri che un’analisi di sensibilità ha identificato più determinanti sul risultato.
In particolare:
Dove:
r
è la funzione di densità di probabilità a
posteriori del rateo di corrosione Ce, date
N misurazioni indipendenti di perdita di
spessore
= ('y1, 'y2,… 'yN);
è la funzione di densità di probabilità a
priori del rateo di corrosione Ce;
è la funzione di densità di probabilità
condizionata congiunta di N misurazioni
indipendenti di perdita di spessore sul
reale rateo di corrosione ce.
r
r
il parametro Ar/t ovvero il parametro che fornisce la stima dell’ammontare della perdita di spessore;
il rapporto di “eccesso di metallo” ovvero il rapporto tra
lo spessore e lo spessore minimo di calcolo;
il rateo di corrosione stimato.
Il tutto potrà essere gestito dall’immancabile applicativo informatico che permetterà, per gli utilizzatori meno esperti,
di condurre le analisi mediante le impostazioni predefinite
per le distribuzioni delle variabili (il “default”) e, per i più
esperti (e senza problemi di tempo), di entrare nella definizione di ciascun parametro caratteristico della distribuzione
di ciascuna variabile aleatoria del problema.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
623
S. Pinca - Recenti sviluppi della RBI - Risk Based Inspection dell’American Petroleum Institute: l’integrazione con la tecnologia del FFS...
10. Considerazioni conclusive
La costante manutenzione della tecnologia RBI operata
attraverso il contributo degli utilizzatori e delle applicazioni consolidate in altre discipline ingegneristiche quali il
FFS (Fitness for Service), è senza dubbio un punto di forza dell’impianto normativo e delle pubblicazioni tecniche
dell’American Petroleum Institute. Tuttavia l’eccessiva fiducia nel mezzo informatico per l’esecuzione dei calcoli e
per la gestione di vaste moli di dati, non deve comunque
prescindere dalla consapevolezza che la competenza tecnica dell’analista risulterà sempre determinante nel successo
dell’applicazione. Inoltre una certa perplessità coglie co-
munque un’utilizzatore mediamente esperto della tecnologia RBI, in relazione alla possibilità di ottenere tutti i dati
richiesti per la valutazione, in considerazione dell’applicazione su larga scala per la gestione del rischio su sistemi di
impianto composti da più di 10000 item, ognuno caratterizzato da una propria valutazione. Ed è proprio di fronte a tale
constatazione che è bene ricordare che la tecnologia RBI è
nata e si è sviluppata quale strumento di supporto decisionale a chi è chiamato a definire:
r
r
r
quando ispezionare;
dove ispezionare;
con quali tecniche ispezionare.
BibliograÀa
[1] Atti del convegno SAFAP: “Sicurezza ed affidabilità delle attrezzature a pressione - La gestione del rischio
dalla costruzione all’esercizio”, Napoli 2012 - INAIL
[2] API RP 580: “Recommended Practice for Risk-Based Inspection” - Second Edition, November 2009 - American Petroleum Institute
[3] API RP 581: “Risk-Based Inspection Technology” - Second Edition, October 2008 - American Petroleum
Institute
[4] API Pubblication 581: “Based Resource Document On Risk-Based Inspection”, May 1996 - Preliminary
Draft - American Petroleum Institute
[5] API BRD 581: “Risk Based Inspection - Base Resource Document” - Edition 2000 - American Petroleum
Institute
[6] API 579-1/ASME FFS-1: “Fitness for Service” - Edition 2007 - American Petroleum Institute
[7] R.Z. Guo, D.A. Osage, P.A. Henry: “Risk Based Inspection for wall thinning damage using API Risk-Based
Inspection planning technology” - WRC Bulletin (Draft)
[8] Canale et al. : “Vulnerabilità dei giunti saldati e meccanismi di danneggiamento attivi negli impianti di processo e petrolchimici: affidabilità mediante la programmazione dell’ispezione basata sul rischio (RBI)”, Rivista Italiana della Saldatura, numeri 3 & 4 / 2011.
Stefano PINCA, laureato in Ingegneria Meccanica all’Università di Genova nel 1994. Funzionario dell’Istituto
Italiano della Saldatura dal 1995, attualmente Responsabile Pianificazione Commesse IIS Service S.r.l., svolge attività
di consulenza nel campo del calcolo delle strutture e componenti saldati, valutazione di affidabilità, programmazione
delle ispezioni di impianto basata sul rischio (Risk Based Inspection). È certificato European / International Welding
Engineer e Livello 2 PT-MT-RT EN 473.
624
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
.
www.grafocom.it
Struttura solida, qualità costante
TECNOELETTRA S.p.A.
via Naz
Nazionale, 50a-70 - 23885 Calco [LC] Italy - tel. +39 039 9910429 - fax +39 039 9910431 - [email protected] - www.tecnosa.it
COMPETENZA NELLA
SALDATURA DI GIUNZIONE
BÖHLER WELDING – UNO SPECIALISTA IN UN GRANDE GRUPPO
Sin dai primi inizi della tecnologia di saldatura il marchio Böhler Welding è stato un
pioniere tecnologico nei consumabili di saldatura. Una gamma completa di prodotti con
particolare focus sugli acciai di grado medio-alto legato copre la maggior parte delle
applicazioni industriali e dei processi di saldatura. Dal 1926 saldatori ed ingegneri in oltre
100 paesi hanno riposto la loro fiducia nei prodotti Böhler Welding.
Böhler Welding Group Italia Spa | Tel. 0239017.1 | mail: [email protected] | www.btw.it
www.boehlerweldinggroup.com
Per una giunzione
perfetta
ž
Y\iZfn\c[
Fili high-tech base rame per soluzioni
avanzate di saldatura e brasatura.
giunzioni ad alta resistenza
ideali per giunti con elevati gap
alta resistenza alla corrosione
www.bercoweld.com
6WDWHRIWKHDUWIRUÁDZDVVHVVPHQW
RISLSHOLQHJLUWKZHOGV(°)
H. Pisarski *
Summary / Sommario
Currently there are a number of fracture mechanics based
procedures for assessing the acceptability of flaws in pipeline girth welds. These are designed to relax workmanship
flaw acceptance criteria, which are often based on flaw
length alone, and to provide a means of deciding acceptability of flaws found by ultrasonic testing where information on height, position through the pipe wall thickness, as
well as length are provided.
The potential benefits of these procedures are a reduction
in costs by minimising the need for repair and delay imposed. This is achieved without compromising the integrity
of the weld. The established procedures are designed for
applied stresses below the yield strength of the material.
Methods based on BS 7910 and API 1104 are introduced.
Strain based procedures, where the applied strain exceeds
the yield strain, are described and compared.
These are the DNV RP F108 procedure, which is primarily concerned with pipeline installation, and the more
recently developed strain capacity methods developed by
ExxonMobil and PRCI CRES for pipelines subjected to internal pressure combined with axial plastic loading.
Nel contesto della meccanica della frattura esistono, allo
stato attuale, diversi approcci per valutare l’accettabilità
dei difetti nelle saldature circonferenziali di tubazioni.
(°) Memoria presentata al Convegno IIS: “La saldatura nella fabbricazione e nella manutenzione di oleodotti e gasdotti in acciaio:
come stanno cambiando processi, materiali, tecnologie e normative” - Milano, 22 Marzo 2012, TWI Ltd, 2012
* TWI Ltd, Cambridge, UK
Questi si traducono nel tentativo di ridurre i criteri di accettabilità basati sulla buona pratica - che spesso tengono in
considerazione esclusivamente la lunghezza del difetto - e
nel tentativo di fornire uno strumento per valutare i difetti
rilevati attraverso il controllo ultrasonoro, che fornisce informazioni quali altezza, posizione rispetto allo spessore
del tubo e lunghezza del difetto. Il potenziale vantaggio di
tali procedure è la riduzione dei costi, ottenuta attraverso
la ridotta necessità di riparazioni e di tempo che ne consegue. Tutto ciò è ottenuto senza compromettere l’integrità
del giunto saldato. Le procedure sono concepite per l’applicazione di sollecitazioni al di sotto del carico unitario di
snervamento del materiale. I metodi sono basati sugli standards BS 7910 e API 1104. Nel caso in cui la deformazione superi il limite elastico del materiale sono introdotte e
confrontate procedure basate sull’analisi delle deformazioni. Tali procedure sono comprese nella Raccomandazione
DNV RP F108, che tratta principalmente l’installazione di
condotte ed i più recenti metodi sviluppati da ExxonMobil
e PRCI CRES per tubazioni soggette a pressione interna e
carico assiale.
IIW Thesaurus Keywords:
Acceptance; defects; frac mech tests; fracture mechanics;
fracture toughness; offshore structures; pipeline steels;
pipelines; welded joints.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
627
+3LVDUVNL6WDWHRIWKHDUWIRUÁDZDVVHVVPHQWRISLSHOLQHJLUWKZHOGV
1. Introduction
Fracture mechanics based assessment procedures are commonly used to provide flaw acceptance criteria for girth
welds in pipelines operating in onshore and offshore
environments. Generally, these permit larger flaws than
those based on so-called ‘workmanship based’ criteria
described in pipeline welding codes such as API 1104 [1]
and DNV OS F101 [2]. This results in a lower repair rate
and decreased costs, mainly by reducing the delay to installation, but without any decrease to the integrity of the girth
welds. Indeed, there have been instances where an improperly executed repair has initiated failure.
The fracture mechanics based procedures such as those described in BS 7910 [3], provide a quantitative means for
deciding which welding flaws, identified by non-destructive
testing, potentially compromise pipe integrity with respect
to defined failure criteria and require repair and those that do
not. In addition, most workmanship based flaw acceptance
criteria are based on the assumption that weld inspection is
carried out using radiography, so flaw acceptance is generally defined with respect to length and flaw type.
Information about the flaw height, which primarily governs
the stability of the flaw, is not provided. This is because
with radiography, tight planar or crack-like flaws cannot be
sized and are likely to be missed, unless they are favourably orientated with respect to the X-ray beam. However,
ultrasonic based inspection methods are well suited to finding planar or crack-like flaws and techniques such as AUT
are increasingly being used to inspect pipeline girth welds.
Ultrasonic methods have the potential for providing more
information about flaws that may be present in the weld,
628
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
especially regarding their height, length and through wall
position. These dimensions have a significantly greater effect on integrity than flaw length alone. After making suitable adjustments for flaw sizing uncertainty, fracture mechanics methods are necessary to interpret such data in order to
sentence welding flaws for acceptance or repair. One aspect
of fracture mechanics based analyses that must be recognized at the outset is that all flaws identified are treated as
cracks for the purpose of assessment. This does not necessarily mean that they are cracks but that treating them as
such is conservative. Current fracture mechanics assessment
procedures are unable to quantify the reduction in severity of
non-planar welding flaws such as slag and lack of penetration. However, ultrasonic inspection methods that are capable of distinguishing between sharp and non-sharp planar
flaws are being developed at TWI together with the associated fracture mechanics assessment methods.
Currently, most of the fracture mechanics methods that are
applied to assessment of pipeline girth welds are essentially
stress-based, although the limits are often expressed in terms
of strain, for example API 1104 Appendix A limits stress
based assessment to 0.5% strain and DNV OS F101, Appendix A to 0.4% strain. This implies that they are not strictly
applicable when the applied longitudinal stress exceeds the
actual yield strength of the pipe. For many pipeline installation methods and operating conditions, the applied longitudinal stress is below the specified minimum yield strength.
However, there are a number of installation methods, such
as pipe reeling, which are used for offshore pipelines where
the pipeline is subjected to plastic straining often involving
more than one cycle. The strains developed during installation depend on the pipe and reel diameters but are typically
in the range of 1-3%. During service, both offshore and onshore pipelines can be subjected to ground movement (eg
seismic loading, landslip) or temperature changes resulting
in lateral buckling which produces axial plastic straining in
addition to internal pressure. Under these extreme loading
conditions it is essential that any flaws in the girth weld do
not extend sufficiently to cause release of pipe contents or initiate unstable fracture. Strain-based fracture mechanics assessment procedures are applied when the axial strain on the
pipe exceeds the yield strain of the pipe material. They are
being developed but a general, codified assessment method
is yet to be agreed. Furthermore, they are significantly more
complex than stress-based methods; they require more input
in terms of material properties, loading data and assessment.
Use of 3-D elastic-plastic finite element analysis is sometimes employed followed up with full-scale validation testing for critical projects, but often the timeframe imposed by
pipeline projects prevents extensive use of such techniques.
In this paper three strain-based procedures are described.
The DNV RP F108 [4] procedure, which has been available since 2006, is primarily designed for the assessment of
flaws when plastic straining takes place during installation,
the ExxonMobil and PRCI CRES procedure for pipelines
+3LVDUVNL6WDWHRIWKHDUWIRUÁDZDVVHVVPHQWRISLSHOLQHJLUWKZHOGV
are applicable to situations when there is combined internal
pressure and axial straining.
2. Stress-based assessment procedures for ÁaZ
acceptance
A general procedure that has been used extensively in the
pipeline industry, especially with respect to the assessment
of girth welds, is BS 7910 [3]. Although it is a general procedure, it provides a robust framework based on fracture
mechanics principles. The procedure not only enables flaw
significance to be assessed with respect to avoidance of
failure by fracture or plastic collapse, the effects of stable
crack extension by ductile crack growth (tearing) and fatigue
crack growth can be incorporated. It also incorporates the effects of welding residual stresses in the fracture assessment.
Guidance is provided on the residual stress distribution that
can be used, if this has not been measured, and the welding
parameters are known. When these are unavailable or the
precise through wall location of the flaw is not known, the
procedure assumes that the residual stress transverse to the
weld is uniform and is of yield strength magnitude. Where
the weld metal strength over-matches that of the parent pipe,
the yield strength assumed is that of the parent pipe. The
assumption of yield residual stress has been criticised as too
conservative. However, it is often forgotten that the procedure allows this stress to be relaxed to a lower value depending on the applied stress and flaw size. Future revisions of
BS 7910 will incorporate more comprehensive guidance for
girth welds [5]. Ignoring residual welding stresses is potentially dangerous since their presence will increase the driving force for fracture. In this context it is of interest to note
that the 2007 amendment to the 20th edition of API 1104
[1] does not appear to specifically address welding residual
stresses. This flaw assessment procedure is based on fracture
mechanics methods and was designed to meet the particular
requirements of pipeline girth welds. It provides a method of
calculating flaw acceptance which is an alternative to workmanship based flaw acceptance given in the main document.
It is CTOD based. It implies that residual stresses are only of
concern when materials with very low fracture toughness are
considered and such materials are excluded from the assessment because the minimum CTOD determined in standard
fracture toughness tests has to exceed 0.05 mm at the assessment temperature [6].
A feature of BS 7910 which is particular relevant to girth
welds but not apparent in API 1104 Appendix A, is its treatment of misalignment or “hi-lo”. Misalignment arises from
poor fit-up, differences in wall thickness between abutting
pipe and pipe ovality. These give rise to a local stress concentration. This is treated as a bending stress which is derived from equations providing stress concentration factors.
Misalignment can have a significant effect on increasing the
driving force, as will be shown later.
However, within the context of BS 7910 it is not clear
whether the bending stress that is generated by misalignment
should be treated as a primary stress, that is, contributing to
both fracture (Kr) and plastic collapse (Lr) axes of the failure
analysis diagram (FAD), or a secondary stress, in which case
it does not contribute to plastic collapse. Currently, BS 7910
provides little guidance on this. The conservative approach
is to treat misalignment as a primary stress. Recent work
at TWI [7] has shown that for materials with smoothly rising stress-strain curves and for applied strains below yield,
misalignment can be treated as a secondary stress; that is,
it acts as a local stress concentration and does not contribute to plastic collapse (Lr axis of the FAD) but contributes
only to the fracture axis (Kr). For strains above yield strain,
misalignment starts to contribute to the primary stress in addition to the secondary stress. Similar conditions apply to
materials with a yield discontinuity (Lüders plateau) but the
applied strain at which misalignment can be treated as secondary needs to be below 0.3%. API 1104 Appendix A does
not specifically consider misalignment; although the “safety
factor” of 1.5 applied the flaw length calculation may be an
attempt to cater for such effects. However, the lack of specific guidance on misalignment given in API 1104 Appendix
A limits its versatility in comparison with BS 7910.
It is of interest to compare the results from assessments of
maximum allowable flaw size conducted to API 1104 Appendix A, Option 2 (Option 2 allows direct general assessment whilst Option 1 is a simplified graphical procedure)
and BS 7910 using the Level 2 FAD procedure. This is the
normal assessment procedure when single values of fracture
toughness are available. Figure 1 shows the results of
the comparison for a girth weld in 42 in diameter pipe
with 22 mm wall thickness with the specified minimum
tensile properties of API 5L Grade X65 [8]. A CTOD fracture toughness of 0.5 mm was assumed, and an applied axial
membrane stress of 85% SMYS. The comparisons were
made with and without residual stresses and with and without the safety factor on flaw length in the API 1104 procedure
to provide a truer comparison with BS 7910. In addition,
the BS 7910 assessment includes material showing a yield
discontinuity or Lüders plateau in the stress-strain curve. It
is clear from Figure 1 that if no residual stresses are assumed, larger flaws are allowed by the BS 7910 procedure
compared with API 1104 procedure, irrespective of whether
the safety factor on flaw length is included or not in the API
1104 assessment. If residual stresses are included in the BS
7910 assessment, which would be the normal situation, the
allowable flaw size is reduced significantly and larger flaw
height are permitted by API 1104 than BS 7910 for flaw
lengths less than 146 mm to 276 mm depending on whether
the API 1104 safety factor on flaw length is included or not.
For the applied stress considered in this example the effect
of the yield discontinuity in the stress-strain curve is not significant until the flaw length exceeds approximately 500 mm
when the allowable height is reduced. It may be noted that
API 1104 limits the allowable flaw length to 12.5% of the
pipe circumference which, in this example, is 418 mm.
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
629
+3LVDUVNL6WDWHRIWKHDUWIRUÁDZDVVHVVPHQWRISLSHOLQHJLUWKZHOGV
Figure 1 - Comparison of predicted maximum tolerable surface flaw sizes for a girth weld in a 42 in OD x 22 mm WT, X65 pipe and CTOD of
0.5 mm using different assessment procedures. (Unless other stated, the BS 7910 assessments assume tensile welding residual stress). Derived from
Smith & Pisarski, [8].
Despite these differences it should be noted that the assessment procedures are not inherently unsafe.
Validation studies using both results from full-scale pipe
tests and wide plates confirm that both BS 7910 and API
1104 assessments can result in safe assessments.
Examples of validation studies employing full scale pipe
tests are shown in Figures 2 and 3.
It is the factors such as the treatment residual stress and
treatment of misalignment and what weight is given to margins on safety that gives rise to differences.
Figure 2 - Results from full-scale results pipe tests assessed using API
1104 Appendix A 2007, Option 2 and BS 7910 Level 2A procedures and
compared with the failure analysis diagram. From Smith & Pisarski, [8]
630
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
3. Strain based assessment methods
DNV RP F106 assessment procedure
Installation of submarine pipelines often employs methods
which impose large plastic strains on the pipe. For example,
a pipe laid by reeling involves a plastic strain cycle ranging from 1 to 3% depending on the pipe and reel diameters.
The application of stress based methods to assess the significance of flaws in the girth welds would be unsuitable.
Figure 3 - Full-scale pipe tests assessed to Option 2 of API 1104,
Appendix A using measured tensile properties. From Wang et al, [6].
+3LVDUVNL6WDWHRIWKHDUWIRUÁDZDVVHVVPHQWRISLSHOLQHJLUWKZHOGV
However, there was an industry need to develop an assessment method since having a zero tolerance approach to
welding flaws would be uneconomical. To respond to this
challenge a method was developed by a team involving
DNV, TWI and SINTEF; it is now codified in a DNV
Recommended Practice, DNV RP F108 [4]. The procedure
is also referred to in DNV OS F101 [2], which is concerned
with offshore pipeline design in general. The novel features
of the method are that the stress-strain curve from the parent
pipe is used to derive the stress from the maximum reeling strain for each stage in the reeling process (reeling-on,
reeling-off and including straightening).
Therefore the shape of the stress-strain curve up to the ultimate tensile strength is critical to the successful application
of the method. The procedure accommodates misalignment
at the girth weld, which can locally increase strain, by using
a combination of the elastic stress concentration factor and
the Neuber method to transform stress into strain.
These strains are additive to the globally applied strain.
The Neuber equation is stated as follows:
VNeuber HNeuber
= Vnominal Hnominal Kt2
Kt
= theoretical elastic SCF (given in BS
7910 or DNV OS F101)
= nominal stress (excluding SCF)
Vnominal
= nominal strain (excluding SCF)
Hnominal
= actual stress (including SCF)
VNeuber
HNeuber
= actual strain (including SCF)
The intersection of the Neuber curve (viz the right hand
side of the equation) with the stress-strain curve provides
the stress (and strain) which includes the effect of the stress
concentration and this is the input into the analysis.
This increase in stress over the stress without misalignment
is often treated as a primary bending stress when input into
the BS 7910 assessment procedure. Such analyses are best
conducted using the material true stress-true strain curve but
for small applied strains the difference is small.
The stress-based procedure in BS 7910 puts a limit or cut-off
to the Lr axis of the FAD based on the flow stress which is
defined as the average of the yield and tensile strengths of
the pipe. In DNV RP F108 cut-off can be derived by experiment or defined as the ratio of the ultimate to yield strength
of the parent pipe. The effect of this is to extend the FAD to
higher values or Lr in the FAD.
The effect of misalignment on driving force is significant,
especially at high strains. An example of the use of the Neuber method is shown in Figure 4 [8]. Misalignment was
modeled by making one of the pipe diameters larger than
the other. Finite element analyses were also conducted for
comparison. (In this example the analyses were conducted
using CTOD as a driving force parameter instead of J which
is recommended in DNV RP F108). For the case considered, the CTOD requirement is approximately doubled at
applied strains close to yield (0.5% strain) when misalignment is increased from zero to 1.5 mm. For larger strains,
Figure 4 - Comparison of CTOD driving force curves for a 3 x 50 mm circumferential surface crack in a 400 mm OD x 20 mm WT pipe with misalignment (e) of 0 and 1.5 mm in a girth weld of width 10 mm, from Smith & Pisarski, [8].
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
631
+3LVDUVNL6WDWHRIWKHDUWIRUÁDZDVVHVVPHQWRISLSHOLQHJLUWKZHOGV
the difference increases. It is clear from Figure 4 that the
DNV RP F108 procedure can be non-conservative; for zero
misalignment FEA predicts a higher CTOD driving force).
There are number of factors that mitigate this apparent nonconservatism and these are discussed later.
Since reeling involves the application of more than one strain
cycle and a reversal of strain, consideration needs to be given
on which part of the strain cycle contributes to crack extension. Based on numerical analyses and experiment, all positive strain increments are considered to contribute to crack
extension, even when the pipe is nominally in compression
at that stage during installation. In practice this means the
maximum strain achieved during reeling on and the pipe
bending over the aligner (including the effect of misalignment) need to be assessed separately for possible crack extension from a hypothetical flaw. The stress derived from the
stress-strain curve is used to determine both the fracture (Kr)
and plastic collapse (Lr) axes of the failure analysis diagram
(FAD). Specifically, the stress is treated as a primary stress
which is used to determine stress intensity factor and reference stress for the Kr and Lr axes, respectively. The reference
stress is derived from the Kastner equation in BS 7910 (see
P. 4.3.2 of the standard) [3]. The Level 3B FAD described in
BS 7910 is employed, since it permits stable ductile crack
extension to take place but to still avoid failure by unstable fracture and plastic collapse. Ductile crack extension
is derived from a J resistance curve obtained from a SENT
fracture toughness test, which is described later. Each strain
cycle has to be assessed separately and the flaw size updated
for crack extension. Instability is defined as the condition
when the driving force exceeds the resistance of the material. In terms of the FAD, the limiting condition is tangency
of the resistance curve to the FAD. However, according to
DNV RP F108, a limit of 1 mm is imposed on the total maximum crack extension allowed. This implies that there is a
margin before a true failure condition is reached.
The need for weld metal strength overmatching is critical
to the successful application of the assessment method. The
weld metal stress strain curve is required to be higher than
that of the parent pipe up to the maximum strain experienced
during installation. Overmatching “protects” flaws contained
by the weld metal by preventing strains from concentrating
here. It should be noted that although weld metal strength
overmatching is required, the weld metal properties do not
enter into the calculations; the assessment is only based on
the parent pipe tensile properties.
Since the pipe can have a range of strengths above SMYS,
the weld metal must be stronger than the highest pipe
strength supplied. Furthermore, since the fracture mechanics
analysis uses the stress-strain curve to establish stress from
the applied strain, the highest strength pipe must be used in
the analysis to ensure that the stress is not underestimated.
For practical purposes, the mean plus two standard deviation stress-strain curve is used in the assessment. It may be
noted that DNV OS F101 [2] limits the difference between
the maximum and minimum longitudinal parent pipe yield
strength to 100 MPa maximum in order to limit excessive
demands on weld metal yield strength.
Figure 5 - 3 x 50 mm surface flaw at weld root fusion boundary in a X65 pipe with OD = 324 x 20.6 mm WT. Homogeneous material (parent pipe)
was employed in the reeling procedure (DNV-RP-F108) and both homogeneous and 20% weld strength overmatched materials employed in the
numerical (FE) analyses [9].
632
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
+3LVDUVNL6WDWHRIWKHDUWIRUÁDZDVVHVVPHQWRISLSHOLQHJLUWKZHOGV
Figure 6 - Comparison of the effect of using the Kastner equation for
pipe and flat plate equations for reference stress on J driving force
estimated using the Level 2b FAD in BS 7910 relative to finite element
analyses for a 3x100 mm surface crack in a 273x20 mm X65 pipe [11].
Although the procedure was validated by full-scale testing
of pipe subjected to repeated plastic straining simulating
reeling operations, subsequent numerical analyses studies
have shown that it can be potentially non-conservative if
all the criteria defined in DNV RP F108 are not adhered to.
However, Pisarski & Cheaitani
[9] have shown that conservatism can be maintained
if weld metal yield strength
overmatching is achieved and
welding residual stresses are
not ignored but treated in accordance with BS 7910 recommendations. This is illustrated in Figure 5 where the
effect of weld metal strength
over matching in reducing the
J driving force in comparison
with an even matched or homogeneous material (in the
absence of residual stresses)
is illustrated.
Recent work has also indicated that there are limitations in the use of the Kastner equation to determine the
reference stress in the FAD.
The Kastner solution can be
considered to provide a com-
bination of local and global
collapse conditions for surface flaws in pipes. Since
the elastic plastic driving
force estimated by the assessment line in the FAD
is critically dependent upon
the reference strain at high
Lr values, a local collapse
reference strain may be
more appropriate. Use of
a flat plate reference stress
solution has been suggested
[10] as a simple expedient.
Its effect on the driving
force compared with what
are considered to be accurate 3D - finite element
analyses predicting J driving force (based on work
carried out at TWI) is illustrated in Figure 6 [11].
One of the features of the
DNV-RP-F108 assessment
method is that it is primarily concerned with analysis
of surface flaws; there are no specific solutions given for embedded flaws. Although embedded flaws can be analysed according to BS 7910, it is considered that the solutions given
are not appropriate for embedded flaws in pipes subject to
plastic strains and are considered to be over pessimistic.
Figure 7 - Finite element analysis prediction of CTOD driving force
versus axial strain in a 400 mm OD x 20 mm WT X65 pipe with and
without internal pressure in the presence of a surface crack 3 mm high
and 50 mm long [11].
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
633
+3LVDUVNL6WDWHRIWKHDUWIRUÁDZDVVHVVPHQWRISLSHOLQHJLUWKZHOGV
Indeed, the solutions given in BS 7910 have limitations
since they refer the user to flat solutions to determine both K
and reference stress and more appropriate solutions would
be desirable. The simple expedient adopted in DNV-RPF108 is to assume that the allowable height of the surface
flaw as the same as the allowable total height of the embedded provided that it is not closer to the nearest surface than
the allowable surface height; otherwise it is considered to be
surface breaking.
Finally, it should be noted that the DNV RP F108 procedure
is designed for pipe under axial loading (in tension or bending) without internal pressure. The reason for this is that
driving force is increased significantly when internal pressure is present in addition to axial strain. This is illustrated
in Figure 7. For case shown, the CTOD driving force is approximately doubled by the addition of an internal pressure
giving a hoop stress of 80% SMYS.
One way of “correcting” the procedure for internal pressure
is to elevate the stress-strain curve by correcting it by the
Von Mises equivalent stress.
DNV RP F108 fracture toughness assessment
Another novel feature of the DNV RP F108 procedure
concerns the type of specimen used in fracture mechanics
testing. Fracture toughness is determined using the surface
notched, single edge notch tension (SENT) specimen. This
specimen design has been found to be more representative
of pipe fracture behaviour than the more conventional and
standardised, deeply notched, single edge bend specimens
(SENB). This is because the crack-tip stress-strain field in
the specimen (or crack-tip constraint) better replicates that
in a circumferential crack in a pipe than does a standard,
deeply notched SENB specimen which provides significantly higher crack tip constraint [12]. A consequence is that
higher fracture toughness is determined using SENT compared with SENB specimens. Fracture toughness is defined
by a J-integral resistance curve, since it is assumed that, for
the materials and temperatures involved during installation,
upper shelf performance will be achieved and unstable fracture by cleavage (in ferritic steels) will not take place.
The geometry of the SENT specimen is shown in Figure 8.
Rectangular or square section specimens are permitted and
these can be either pin-loaded or clamped using wedge or
hydraulic grips, as illustrated. For the clamped specimen,
which is the usual way of gripping the specimen, the daylight between the clamps is defined as ten times the specimen
width. (The specimen width is based on the pipe wall thickness). If pin loading is employed, the only practical method
of achieving this with the notch orientation employed is to
clamp the specimen and then pin load the clamp. The specimen is surface notched and fatigue cracked to a depth ranging between 20 and 50% of the specimen width. Specimens
are notched and fatigue precracked to test the weld metal
(either from the weld cap or root side) and HAZ as illus634
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
Figure 8 - SENT specimen to DNV-RP-F108, B = W or 2W, H = 10W
Figure 9 - Girth weld showing notch locations
trated in Figure 9. A notch from the weld cap side is often
used to test the HAZ to minimise problems with missing
the target HAZ if the fatigue crack front is bowed or longer
than expected. However, a feature that has been observed
+3LVDUVNL6WDWHRIWKHDUWIRUÁDZDVVHVVPHQWRISLSHOLQHJLUWKZHOGV
in such tests is that ductile crack extension tends to move
the growing crack tip away from the weld fusion boundary
and into the lower strength parent pipe. The SENT testing
procedure is intended to be applicable to ductile materials
(it is not generally applicable to situations where the SENT
specimen fail by cleavage), and to girth welds which have
a higher yield strength than the parent pipe (ie overmatch).
There is no fundamental reason why results from SENT
specimens that fracture by cleavage should not be used in an
assessment. However, there is concern that since cleavage
is sensitive to changes in crack-tip constraint, increases in
crack-tip constraint in the pipe girth weld due to variations
in geometry and/or material could trigger cleavage at lower
fracture toughness than that determined by the SENT test.
4. Other strain-based assessment procedures
A number of research workers in UK, Norway [13] and
North America have been developing specific strain-based
assessment methods for pipeline girth welds. These are designed for over-land pipelines and are capable of dealing
pipelines subjected to axial straining and internal pressure
acting in combination. (It may be noted that DNV procedure
was designed for axial straining only without internal pressure). In the case of North American developments, the emphasis has been on predicting strain capacity of the pipeline
when the girth weld contains welding flaws. In Europe, the
emphasis has been more on defining flaw acceptance criteria which are used to define inspection regimes. In North
America there are two strain-based assessments methods
for the design of pipelines; a PRCI and US Department of
Transportation sponsored project [14], [15] and [16] which
is in the process of being published and is referred as the
CRES procedure and one developed by ExxonMobil. Both
procedures are based on extensive numerical analysis and
full-scale pipe tests to derive parametric equations to define
strain-capacity. The recommendations from the ExxonMobil
have been published in the open literature [17], [18] and [19]
together with some of the back-ground work.
ExxonMobil procedure
In the ExxonMobil procedure CTOD (crack tip opening displacement) is used as the fracture characterizing parameter.
Three levels of assessment are proposed, with each higher
level providing a less conservative assessment and requiring
more sophisticated information about material properties. It
is applicable to pipe with strengths from X65 (448 MPa)
to X80 (551 MPa). The procedures have been developed by
conducting thousands of finite element analyses to develop a
series of parametric equations to define strain capacity. They
were validated by approximately 50 full-scale tests with and
without internal pressure. The pipe strength tested ranged
from API 5L X60 up to X80, pipe diameters from 8 in up
to 42 in and pipe wall thicknesses from 12.7 up to 25.2 mm.
Figure 10 - Comparison of strain capacity determined from full-scale
tests on X65 to X80 pipes with predictions using the ExxonMobil Level
3 analysis method, from Kibey et al., [17]
The procedures are not applicable to girth welds where there
is strength under-matching. However, it should be noted that
ExxonMobil define strength mismatch in terms of the ultimate tensile strength rather than the usual yield strength
definition. To date, Level 1, the most basic or screening level, and Level 2, an intermediate level, have been published
[19]. Both methods include inherent safety factors so that
when the predictions of strain capacity are compared with
full-scale test data there is a margin of safety. This is higher
for Level 1 than for Level 2. Level 3 is based on three–dimensional finite element analysis of the pipe where the limit
state is defined a ductile instability. That is tangency between the FEA derived CTOD driving force and the CTOD
resistance curve determined by experiment. Levels 1 and 2
are in fact, simplifications of Level 3 assessments. Figure
10 compares the predicted strain capacity using the Level
3 method with experimental results from full-scale tests on
X65 to X80 pipes. As can be seen from the results, there is
no inherent factor of safety at Level 3.
At Level 1, strain capacity is defined as a function of crack
size, pipe wall thickness and weld strength overmatch (in
terms of tensile strength). Internal pressure is included and
set to be equivalent to a hoop stress of 80% specified minimum yield strength. Fracture toughness is not required since
a lower bound resistance curve is assumed which is based on
experimental data. A fixed value of misalignment of 3 mm
is assumed and the uniform elongation to tensile strength in
the standard tensile test is set at 6%.
At Level 2, strain capacity is dependent on: crack size
(height and length), misalignment at the girth weld, weld
metal strength overmatch, pipe wall thickness, strain hardening (defined in terms of yield to tensile ratio), uniform
elongation of the pipe material, fracture toughness (in terms
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
635
+3LVDUVNL6WDWHRIWKHDUWIRUÁDZDVVHVVPHQWRISLSHOLQHJLUWKZHOGV
of a CTOD resistance curve) and internal pressure. Fracture
toughness in the form of a CTOD resistance-curve obtained
from a SENT test is determined but the results are not directly used in the assessment. Instead, the experimental resistance curve is compared with three reference resistance
curves and the one which is just exceeded is used in the assessment.
The SENT specimen design is similar to that one described
in DNV-RP-F108 (see Figure 8) except that the specimen
has a square cross-section, is side grooved to a depth 5%
of thickness on each side after fatigue precracking and is
loaded by clamping the sides of the specimen. Side grooving increases crack-tip constraint and helps promote straight
fronted ductile crack extension. The initial crack depth to
specimen width ratio is defined to be within the range 0.25 to
0.35. A novel feature of the test is that both fatigue precracks
and notches made by electro discharge machining (EDM)
are permitted.
The wire diameter specified for EDM is 0.15 mm.
A CTOD resistance curve is obtained from the material.
CTOD is derived by simple extrapolation of the opening displacement of a pair of clip gauges mounted above the notch
mouth to the fatigue crack tip.
The range of applicability of the ExxonMobil procedure is
fairly limited for Levels 1 and 2, for example the maximum
tolerable flaw length is limited to 50 mm. Also, the procedure is designed for surface breaking flaws; there is no specific consideration of embedded flaws which, in practice, are
the ones that are most likely to be present in the girth weld.
CRES procedure
The CRES procedure [14, 15, 16] is intended to be applied
to pipes with and without internal pressure when subjected to tensile strains from 0.5% up to one half of the parent pipe uniform elongation. It is applicable to a wide range
pipe strength grades but assumes that any girth weld present
does not under-match the strength of the parent pipe. It uses
CTOD as the fracture characterising parameter but in a different way from the ExxonMobil method. The term “apparent CTOD” is used and refers to the different ways CTOD is
derived. It is also, and perhaps more fundamentally, recognition that with strain-based design fracture toughness is not a
unique material parameter but also depends on the structural
behaviour of the pipe.
It has four levels of analysis, each of increasing sophistication. Level 1 is intended to be a simple screening where
strain capacity is tabulated for a set pipe sizes, tensile properties and flaw sizes. Fracture toughness is derived from
the upper shelf Charpy energy. A correlation is employed
to determine apparent CTOD fracture toughness. Level 2 is
the “normal” assessment procedure and a set of parametric
equations are given to define strain capacity. Fracture toughness is determined from upper shelf Charpy energy, as in
Level 1, or from standard deeply notched bend specimens.
636
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
Upper shelf toughness in terms of maximum load (dm, as
defined in BS 7448 Part 1) is required and the results multiplied by a constant (ranging from 1.5 to 2) in order to “correct” for crack-tip constraint. This corrected fracture toughness is the apparent CTOD used in the assessment. Level 3
is the advanced assessment method which employs the same
parametric equations as Level 2 but utilises the results from
low constraint fracture toughness specimens. These can be
either shallow notched bend tests, SENT tests or curved
wide plate tests.
Level 3 is sub-divided into assessments where the failure
criterion is initiation of ductile tearing (Level 3a) or a ductile
instability (Level 3b). In both cases a CTOD curve is needed. Finally, Level 4 is another advanced assessment which
requires finite element analyses to be conducted on the pipe
and requires the same fracture toughness data as Level 3.
The CRES method has a different set of parametric equations
to predict strain capacity for girth welds made by GMAW
and either SMAW or FCAW. The reason for this is that the
welds have different shapes which affect strain capacity.
Welds made by GMAW are narrower and have steeper edge
preparations than welds made by either SMAW or FCAW.
The procedure was validated by 24 full scale tests. All except two were conservatively predicted by the model. This
was attributed to variability in material properties. CRES
procedure was no in-built safety factors.
5. Comparison of strain-based assessment
procedures
Gordon and Keith [16] have made some comparison of the
DNV RP F108, ExxonMobil and CRES procedures in terms
of allowable flaw sizes predicted by each method for given
values of strain capacity. The comparison was based on a 36
in diameter, 18.4 mm wall thickness pipe to API 5L Grade
X80 (SMYS = 550 MPa) containing a girth weld which overmatched the strength of the pipe by 20%. The analyses also
assumed that there was 3 mm misalignment at the girth weld
and the internal pressure gave a hoop stress of 80% SMYS
of the parent pipe. The fracture toughness employed was the
CTOD R - curve 2 (CTOD resistance curve) defined by the
ExxonMobil Level 2 procedure. The assessments were based
on Level 2 of the ExxonMobil procedure and Level 3 (for
ductile instability) of the CRES procedure. Since the DNV
RP F108 procedure does not allow for internal pressure, two
analyses were undertaken, the first without internal pressure
and the second with internal pressure where the crack driving force (CDF) was increased by a factor of two to account
for biaxiality. (On the basis of the results shown in Figure 7,
this approximation seems reasonable). The results are shown
in Figure 11 together with the range of applicability defined
by each procedure.
The results show that for low applied strains (0.5%) the
DNV RP 108 (corrected for internal pressure) and ExxonMobil procedures give similar allowable flaw heights
for flaw lengths less 100mm. The CRES procedure gives
+3LVDUVNL6WDWHRIWKHDUWIRUÁDZDVVHVVPHQWRISLSHOLQHJLUWKZHOGV
Figure 11 - Comparisons of allowable flaw sizes predicted by the ExxonMobil Level 2, CRES Level 3 and DNV RP F108 procedures for two applied
strains: a) 0.5%, and b) 1.5%, from Gordon & Keith, [16].
generally lower allowable flaw height (for the GMAW welds)
except for flaws less 25mm long. At higher applied strains
(1.5%), the CRES and ExxonMobil procedures give similar
allowable flaw height for flaws less 50mm long. The DNV
RP F108 procedure gives larger allowable flaw heights.
For longer flaws, the allowable flaw height is greater with
the CRES procedure and similar to the DNV RP F108 procedure.
6. Concluding remarks
Stress and strain-based fracture mechanics methods for the
assessment of flaws in pipeline girth welds have been outlined. The stress-based procedure in API 1104 Appendix A
and the general assessment method given in BS 7910 were
compared. Although there are differences, these reflect the
different approaches used and safety factors incorporated;
BS 7910 provides greater versatility to cater for a much wider variation in properties, loadings and geometry than API
1104. However, use of BS 7910 requires a greater level of
expertise than API 1104.
There are no indications that either method is “unsafe” but
the margins of safety are likely to be different. The strainbased procedure given in DNV RP F108 is intended to be
applied to girth welds where the installation method involves plastic straining. It is in fact a modification to the
stress-based method in BS 7910. One of the novel features
of this method is that fracture toughness is derived SENT
specimens which are intended to match the constraint in the
pipe. Fracture toughness is defined by a J resistance curve.
The procedure is intended for materials where cleavage fracture does not take place. Comparison of the J driving force
curves derived from the method with finite element analyses
indicates that driving force might be underestimated. However, predictions of allowable flaw size are considered to be
“safe” since the method does not account for the beneficial
effects of weld metal strength overmatching in reducing
driving force and the conservative treatment of welding residual stresses. The ExxonMobil and CRES procedures are
based on a combination of extensive finite element analyses
and full-scale testing; parametric equations have been developed to define strain capacity of the pipeline when flaws are
present in the girth weld. The methods are capable of dealing with installed pipelines where there is internal pressure
and axial plastic straining. As currently presented, the CRES
procedure has a wider range of applicability.
Both procedures are capable of incorporating the effects of
weld strength overmatching, misalignment internal pressure
and tensile properties of the parent pipe (in terms uniform
elongation).
None of the strain based methods specifically refer to the
analysis of embedded flaws; they concentrate on surface
flaws. Since welding flaws found in girth welds are more
likely to be embedded than surface breaking, the assessment procedures may not be capturing the true condition of
most welding flaws. In addition welding residual stresses are
considered to be negligible when the applied strains exceed
yield strain.
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
637
+3LVDUVNL6WDWHRIWKHDUWIRUÁDZDVVHVVPHQWRISLSHOLQHJLUWKZHOGV
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
API 1104, “Welding of Pipelines and Related Facilities”, 20th edition amended July 2007. American Petroleum
Institute.
DNV-OS-F101, Submarine Pipeline Systems. Det Norske Veritas, Norway, October 2010.
BS 7910:2005 (incorporating Amendment No.1), “Guide to Methods for Assessing the Acceptability of Flaws in
Metallic Structures”. British Standards, London, 2007.
DNV-RP-F108, Fracture Control for Pipeline Installation Methods Introducing Cyclic Plastic Strain, Det Norske
Veritas, Norway, January 2006
Isabel Hadley, Progress Towards the Revision of BS 7910. Proceedings of the Pressure Vessels and Piping Division
Conference, PVP 2011-57307, Baltimore, USA, July 2011.
Y. Y. Wang et al., “A Tiered Approach to Girth Weld Defect Acceptance Criteria for Stress-based Design of Pipelines”. IPC Conference Paper IPC2006-10491, Calgary, Canada, 2006.
Mohamad J. Cheaitani, TWI to be published
Sarah E. Smith and Henryk G. Pisarski, “A comparison of the API 1104 Appendix A and BS 7910 procedures for
the assessment of girth weld flaws”. The Journal of Pipeline Engineering, Vol 9, No 3, Third Quarter, 2010
Henryk G. Pisarski and Mohamad J. Cheaitani, “Development of Girth Weld Flaw Assessment Procedures for
Pipeline Subjected to Plastic Straining”. Int. Journal of Offshore and Polar Engineering, Vol. 18, No. 3, 183-187,
September 2008.
S. L. Bjerke, M. Scultori and S. Wastberg, DNV’s Strain-based Fracture Assessment Approach for Pipeline Girth
Welds. ISOPE Conference Paper, Maui, Hawaii, USA, June 2011.
H.G. Pisarski, “Assessment of flaws in pipe girth welds”, Welding of high strength pipeline steels, CBMM-TMS
International Seminar, 28-29 November 2011, Araxa, Brazil.
Henryk G. Pisarski and Colin M. Wignall, “Fracture Toughness Estimation for Pipeline Girth Welds”. IPC-0227094 Conference, Calgary, Canada, 2002.
Erling Ostby, Fracture Control-Offshore Pipelines. “New Strain-Based Fracture Mechanics Equations Including
the Effects of Axial Loading, Mismatch and Misalignment”, 24th International Conference on Offshore Mechanics
and Arctic Engineering, ASME OMAE2005-67518, 2005.
Y. Y. Wang et al., “Recent Developments in Strain-Based Design in North America”. Proc. 19th International Offshore and Polar Engineering Conference, ISOPE, Osaka, Japan, 2009.
M. Stephens et al., “Large-scale Experimental Data for Improved Strain-based Design Models”. Proc. 8th International Pipeline Conference, Calgary, Alberta, Canada, ASME 2010, IPC2010-31396.
J. R. Gordon and G. Keith, “Defect and strain tolerance of girth welds in high strength pipelines”, Welding of high
strength Pipeline Steels, CBMM-TMS International Seminar, 28-29 November 2011, Araxa, Brazil.
Kibey et al., “Development of a Physics-based Approach for the Prediction of Strain Capacity of Welded Pipelines”, ISOPE Conference Paper, Osaka, Japan, 2009.
Kibey et al., “Tensile Capacity Equations for Strain-based Design of Welded Pipes”. Proc. 8th International Pipeline Conference, Calgary, Alberta, Canada, ASME IPC2010-31661.
D. P. Fairchild et al., “A Multi-tiered Procedure for Engineering Critical Assessment of Strain-based Pipelines”.
ISOPE Conference Paper, Maui, Hawaii, USA, June 2011.
Dr Henryk PISARSKI is a TWI Technology Fellow and works in the Structural Integrity Technology Group of TWI Ltd
in Cambridge, UK. He has been with TWI since 1973. His interests include the application of fracture mechanics based
assessment and testing methods to assure the integrity of welded structures, with respect to fracture avoidance and to
demonstrate fitness-for-service. He is also involved in the development of strain-based procedures for the assessment of
pipeline girth welds. He has managed projects applying fracture mechanics testing and assessment methods to a wide
range of engineering structures including ships, offshore structures, subsea components, pipelines and pressure vessels.
In addition, he has contributed to standards bodies on fracture toughness testing and flaw assessment (ISO 15653, BS
7448 & BS 7910). He has published a number of papers on these subjects and also carried out expert witness work.
He is the UK delegate to IIW Commission X (Structural performance of welded joints – fracture avoidance) and is
contributing to the revision of BS 7910 (flaw assessment).
638
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
NUOVE TECNOLOGIE PER IL TAGLIO AL PLASMA AUTOMATIZZATO
I nostri generatori per taglio al plasma automatizzato di precisione sono dotati di nuove
tecnologie avanzate che offrono profili e bordi più precisi, fori più rotondi, maggiore
produttività e minori costi di taglio.
La tecnologia HeavyCut™ migliora la qualità di taglio e la produttività su acciaio dolce
fino a 50 mm di spessore e consente tagli di straordinaria qualità a minor costo.
La tecnologia Diameter PRO™ permette di tagliare fori di qualità eccezionale senza
bisogno di ulteriori lavorazioni.
Qualunque sia la vostra applicazione, Victor Thermal Dynamics ha la soluzione
per taglio automatizzato giusta per voi.
TM
We Bring Intelligence to the Table.
Contattate il distributore locale o visitate il
sito www.victortechnologies.eu
Victor Thermal Dynamics è un marchio di Victor Technologies ©2012 Victor Technologies
trafimetdistribution.com
ERGOCUT
S 65
ADAPTIVE POWER
YOUR WELDING PARTNER
TORCIA PER TAGLIO PLASMA ERGOCUT S 65
La ERGOCUT S 65 è la nuova torcia Trafimet per
taglio Plasma senza alta frequenza, grazie al suo
progetto innovativo diventa lo standard di riferimento
per le torce da 60 A.
La ERGOCUT S 65 è particolarmente adatta a tutti
coloro che desiderano una torcia professionale e di
semplice utilizzo, è disponibile nelle configurazioni
STANDARD e DRAG.
DURATA RICAMBI
ERGOCUT S 65
COMPETITORS
250
230
CICLI
CICLI
40 A
160
50
105
60
CICLI
CICLI
CICLI
CICLI
50 A
60 A
Trafimet Distribution | Tel. +39 0444 739800 | Fax +39 0444 739899 | [email protected]fimetdistribution.com
5DGLRJUDÀD'LJLWDOHFDUDWWHUL]]D]LRQHGHL
VLVWHPL&5SHUDSSOLFD]LRQLLQGXVWULDOL
S. Rusca *
Sommario / Summary
Il presente articolo analizza gli elementi principali che devono essere presi in considerazione al fine di caratterizzare
un sistema CR (Radiografia Computerizzata) per applicazioni industriali.
Attualmente gli utilizzatori di tali tecnologie possono condurre la caratterizzazione seguendo le indicazioni fornite
a supporto dalle norme EN e ISO che recentemente sono
state proposte e messe a punto sull’argomento.
Questo lavoro intende mettere in risalto la logica che è alla
base di ogni fase della caratterizzazione e non è invece mirato alla quantificazione né al confronto delle prestazioni
dei sistemi CR oggi disponibili sul mercato: è infatti compito di ogni utilizzatore caratterizzare il proprio sistema,
con l’indispensabile supporto tecnico del relativo costruttore, in modo da comprenderne le potenzialità e la capacità
di soddisfare le differenti esigenze nelle applicazioni per le
quali è intenzionato ad adottare la tecnologia CR.
*
Digital Radiography: Characterization of CR (Computed Radiography) Systems for industrial applications
This paper analyzes the main elements to be taken into
account in order to characterize a CR (Computed Radiography) System for industrial application.
Nowadays, users of CR can carry out the characterization
following, as a support, the procedure considered by EN &
ISO standards, that have been recently proposed.
The aim of this work is to underline the logic and the importance of each step and not to quantify performances of
different CR Systems: task of each user indeed is to characterize his own system, obviously sustained by the manufacturer, in order to satisfy needs and requirements of
different applications which he wants to approve CR for.
IIW Thesaurus Keywords:
Automatic control; CEN; computer programs; image quality;
ISO; nondestructive testing; numerical control; radiography;
standards.
Istituto Italiano della Saldatura, Ente Morale - Genova
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
641
65XVFD5DGLRJUDÀD'LJLWDOH&DUDWWHUL]]D]LRQHGHLVLVWHPL&5SHUDSSOLFD]LRQLLQGXVWULDOL
altrettanto vero che il retaggio culturale e la tradizione non
devono incancrenirsi e degenerare in chiusura mentale (e
non solo mentale) a priori.
In queste pagine, tenendo conto di quanto di equilibrato e
sensato c’è in entrambi gli approcci sopra accennati (e non
nelle loro estremizzazioni), si evidenziano gli aspetti più
rilevanti che devono essere affrontati per poter validare i
sistemi di radiografia filmless CR (Computed Radiography)
e renderli fruibili a livello industriale, affiancandoli alle
tecnologie tradizionali, garantendo livelli adeguati di qualità
e affidabilità.
2. Sistemi CR: Generalità
1. Introduzione
Il Controllo Radiografico (RT) è un controllo non distruttivo
volumetrico che negli ultimi anni sta attraversando un
processo di evoluzione molto rapida, analogamente a quanto
sta accadendo anche ad altri metodi, quali il Controllo
Ultrasonoro (UT), il Controllo con Emissione Acustica
(AT), la Termografia (TT).
Gran parte di tale evoluzione riguarda gli aspetti tecnologici
e, in particolare, l’introduzione di sistemi digitali per
l’acquisizione e l’elaborazione delle informazioni ottenute.
Come spesso accade in questi casi e, in genere, quando
si è di fronte ad innovazioni tecnologiche, due sono le
reazioni che si incontrano, nettamente contrapposte tra
loro ma entrambe comprensibili: da un lato, l’entusiasmo
di chi ha messo a punto la tecnologia o di chi è impegnato
a promuoverla, conscio dei risultati che in prospettiva si
possono ottenere, e dall’altro, il rifiuto della novità da parte
di chi non la utilizza, motivato, a volte, dalla ragionevole
constatazione che non c’è necessità alcuna di modificare
qualcosa di consolidato che funziona bene da anni o, a volte,
da un’ingiustificata inedia, approccio, quest’ultimo, che
decisamente mal si concilia con il continuo miglioramento
che la Comunità scientifica e l’Industria devono porre fra i
loro obiettivi primari.
Senza dubbio, la tecnologia sovente evolve in modo molto
più rapido della capacità degli utilizzatori di comprenderne
le proprietà, la reale applicabilità ed i limiti, ovvero
l’entusiasmo rischia sostituirsi al realismo; d’altro canto, è
642
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
La radiografia computerizzata (CR), una delle tecnologie
appartenenti alla famiglia della radiografia digitale (DR),
si differenzia dalla radiografia tradizionale a film (FR) per
la modalità con cui l’informazione viene rilevata, trasferita,
elaborata e visualizzata. Non sussistono invece variazioni
sostanziali negli elementi che si trovano “a monte” del
manufatto da ispezionare: i sistemi a pellicola e quelli
computerizzati sfruttano infatti le stesse radiazioni (RX e
Raggi Gamma) e le stesse tipologie di sorgente (macchine
radiogene, acceleratori lineari, radioisotopi,…).
Un sistema CR, “a valle” del manufatto in esame, è
essenzialmente costituito da una catena i cui anelli essenziali,
fra loro interagenti, sono:
r Imaging Plate (IP): è il rivelatore che sostituisce
la pellicola, l’emulsione sensibile alle radiazioni
ionizzanti negli IP è costituita da grani contenenti i
cosiddetti “fosfori a memoria”, che in realtà hanno
una formulazione chimica molto complessa, basata su
elementi chimici appartenenti alla famiglia delle “terre
rare”.
r Scanner: è il dispositivo che irraggia gli IP, dopo
l’esposizione, con un fascio laser caratterizzato da
lunghezza d’onda compresa nell’intervallo tra 630 e
680 nm (“luce rossa”). Esso sostituisce la sviluppatrice
del sistema tradizionale a film e permette, pertanto, di
trasformare l’immagine latente (stato di eccitazione
dei “fosfori” causata dalla dose di radiazione subita) in
immagine visibile (i “fosfori” rilasciano energia sotto
forma di radiazione nel campo del visibile in risposta
alla stimolazione del laser dello scanner).
r Workstation: è l’elemento hardware che acquisisce
il segnale in uscita dallo scanner e, grazie a software
dedicati, elabora i dati di input per fornire l’immagine
dell’oggetto radiografato; i software sono divisi
solitamente in due tipologie: una di acquisizione e
l’altra di visualizzazione.
r Monitor: è l’elemento su cui l’operatore visualizza
l’immagine della radiografia; esso sostituisce il visore
(negativoscopio) della radiografia a film.
r Cablaggio: è l’insieme degli elementi fisici (cavi,
65XVFD5DGLRJUDÀD'LJLWDOH&DUDWWHUL]]D]LRQHGHLVLVWHPL&5SHUDSSOLFD]LRQLLQGXVWULDOL
connettori, infrastrutture di supporto) che permettono
l’interconnessione dei dispositivi sopra citati; sebbene
rappresentino elementi secondari da un punto di vista
concettuale, sono anch’essi fondamentali da un punto
di vista funzionale, contribuendo al pari degli altri
dispositivi alla qualità finale dell’immagine.
Da quanto descritto nell’elenco precedente, risulta evidente
che la caratterizzazione di un sistema CR non può prescindere
dalla verifica di funzionalità di ognuno degli elementi della
catena di acquisizione ed elaborazione; tale funzionalità
dovrà inoltre essere garantita nel tempo, mantenendo valori
il più possibile costanti o, per lo meno, variabili con legge
nota o determinabile sperimentalmente dagli utilizzatori.
A tal proposito, è importante notare che, se l’utilizzo ormai
secolare dei sistemi a pellicola permette di capire con certezza
quale possa essere la causa o il fattore responsabile di un
cattivo funzionamento, lasciando pochi dubbi interpretativi,
nel caso dei sistemi CR, invece, una delle problematiche
che gli utilizzatori devono fronteggiare è proprio capire
a quale degli “anelli” della catena di acquisizione ed
elaborazione sia imputabile un’eventuale anomalia o,
addirittura, anche in caso di corretto funzionamento, sia
imputabile un risultato non conforme ai requisiti di qualità
imposti dall’applicazione. Probabilmente la ragione di
questa condizione di indeterminatezza va ricercata nel fatto
che i controlli digitali sono stati introdotti da pochi anni
e, in alcuni casi, ancora oggi, non sono nemmeno adottati
in modo sistematico ma piuttosto occasionale; pertanto è
indubbio che molti aspetti sia teorici sia pratico-operativi
sono ancora sconosciuti o noti in modo approssimativo,
specie per quanto riguarda l’elettronica dei componenti ed
alcuni elementi informatici.
In questa sede, per analizzare ordinatamente le fasi di
caratterizzazione degli elementi sopra elencati, è sicuramente
molto utile e formativo procedere seguendo quanto previsto
dalle normative EN e ISO vigenti in materia.
3. Caratterizzazione dei Sistemi CR:
Riferimenti Normativi
I riferimenti normativi europei (prodotti in ambito CEN)
ed internazionali (prodotti in ambito ISO) che trattano il
controllo radiografico con tecniche digitali filmless sono:
r
r
r
UNI EN 14784:2006 per la caratterizzazione del
sistema;
ISO 16371:2011 per la caratterizzazione del sistema;
ISO FDIS 17636:2012 per l’applicazione della
tecnologia al controllo dei giunti saldati.
Nella fattispecie, per lo scopo che si prefigge questo articolo,
i documenti cui si farà riferimento nel prosieguo sono la
parte 1 della norma UNI EN 14784 e la parte 1 della norma
ISO 16371.
Vale la pena sottolineare che i suddetti documenti, di tipo
“trasversale” al metodo RT, sono specificatamente dedicate
alla computed radiography; in altri termini, a livello
europeo ed internazionale, attualmente non esistono ancora
riferimenti dello stesso tipo per le altre tecnologie della
famiglia della radiografia digitale. Le altre tecniche filmless
sono oggetto invece di standard statunitensi quali le ASTM
o di documenti relativi a particolari settori industriali come
quello aeronautico e quello militare.
La terza normativa elencata, ISO FDIS 17636, rappresenta
un riferimento di tipo “verticale” per il prodotto “saldatura”:
essa infatti tratta la messa a punto delle tecniche idonee a
raggiungere determinati livelli qualitativi nell’indagine
radiografica solo di giunzioni saldate.
Da un punto di vista logico e cronologico, inizialmente è
fondamentale stabilire se il sistema in uso ha le caratteristiche
e le potenzialità per soddisfare determinati requisiti di
qualità “assoluti” e tabulati: fase di caratterizzazione
del sistema; successivamente è necessario determinare i
parametri da impostare su tale sistema, già caratterizzato
e ritenuto idoneo, per poter raggiungere i requisiti imposti
nell’applicazione (ovvero nel controllo di giunti saldati, nel
caso specifico di ISO FDIS 17636): fase di scelta e setup
della tecnica, ovvero messa a punto e stesura della procedura
di controllo.
4. Caratterizzazione dei Sistemi CR: Iter di VeriÀca
Il processo di verifica e caratterizzazione dei sistemi CR
prevede l’esecuzione di prove in condizioni standardizzate,
volte alla classificazione e alla determinazione di criteri
univoci di confronto fra i sistemi stessi, realizzati dai
diversi costruttori. Molte di queste prove, in base ai codici
e alle norme di riferimento, sono considerate a carico
dei costruttori, soprattutto a causa della complessità
dell’attrezzatura necessaria e dei lunghi tempi di esecuzione
che comportano.
A queste prove sono poi associate altre più semplici, che
possono essere condotte dagli utilizzatori e che forniscono
risposte più immediate circa le prestazioni dei sistemi CR e
la loro stabilità nel tempo.
Come precedentemente accennato, i fattori che influenzano
la qualità di una immagine ottenuta tramite CR sono
numerosi e includono, fra gli altri, la penombra geometrica
(abitualmente indicata con Ug), il rapporto tra segnale e
disturbo (abitualmente indicato con l’acronimo SNR), lo
scattering, la sensibilità in contrasto; ne esistono poi altri
che agiscono sull’accuratezza della “lettura” dell’immagine
da parte dello scanner e che possiamo raggruppare e
denominare complessivamente “parametri di scansione”.
Ognuno dei parametri sopra citati può essere testato
separatamente oppure è possibile utilizzare un indicatore di
qualità omnicomprensivo, detto “phantom”, che incorpora
più indicatori, ciascuno mirato alla valutazione di uno o più
parametri caratteristici.
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
643
65XVFD5DGLRJUDÀD'LJLWDOH&DUDWWHUL]]D]LRQHGHLVLVWHPL&5SHUDSSOLFD]LRQLLQGXVWULDOL
L’utilizzo del “phantom” o dei suoi singoli indicatori
permette all’utilizzatore dei sistemi CR di avere (e di fornire
ai propri clienti) informazioni sulla qualità del suo sistema,
nelle particolari condizioni di esposizione adottate, le quali
dovranno essere concordate fra le parti e registrate al fine di
poter essere ripetute in fase di verifica periodica, secondo
la frequenza temporale preventivamente e debitamente
concordata.
In merito alla classificazione dei sistemi CR, vale la pena
ribadire che l’appartenenza di un sistema CR ad una delle
classi proposte è il risultato dell’insieme di fattori, operanti
in modo sinergico, di seguito elencati:
r
r
r
r
IP utilizzato;
condizioni di esposizione adottate;
tipo di scanner usato;
parametri di scansione impostati.
Infine, anche se non ultimo in termini di importanza, deve
essere considerato anche il decadimento che l’intensità
dell’immagine incamerata dall’IP subisce nel tempo, prima
che venga eseguita la scansione; questo fenomeno è noto
come “fading” e la sua valutazione, ottenuta tramite una serie
di esposizioni identiche seguite da scansioni opportunamente
ritardate (le norme forniscono precise procedure a tal
proposito), permette di ottimizzare il controllo in funzione
delle specifiche applicazioni.
5. Valutazione Quantitativa dei Parametri di
Qualità dell’Immagine
Misurazione di SNR
Il primo e fondamentale parametro che deve essere valutato
per stabilire le prestazioni di un sistema CR è SNR, ovvero
il rapporto fra il valore medio del segnale, inteso come
valore numerico assunto dai pixel di una immagine digitale
(detto GV, da Grey Value), e la deviazione standard dei GV,
calcolato in una regione di interesse (detta ROI).
In termini più operativi, SNR e GV sono indici della dose
di radiazione assorbita dall’IP e, in ultima analisi, della
“quantità” di informazioni da esso incamerata: è intuitivo
quindi comprendere che un sistema CR deve garantire un
valore minimo di tali grandezze, in funzione della criticità
dell’applicazione, e che, maggiori saranno i valori da essi
assunti in determinate condizioni, migliori saranno le
prestazioni del sistema.
A livello normativo, sono proposti i tre metodi di misurazione
di seguito elencati:
r
r
r
metodo di esposizione a step;
metodo del blocco a gradini;
metodo di misurazione della sensibilità in contrasto.
In questa sede non sono descritte nel dettaglio le singole fasi
di prova dei tre metodi ma, ciononostante, è di particolare
interesse evidenziare alcuni aspetti che li caratterizzano.
Innanzitutto, è importante tenere presente che il grado di
accuratezza cui si giunge è differente: nella fattispecie, i
risultati più precisi sono ottenuti adottando la metodologia
dell’esposizione a step, ritenuta peraltro la più complessa,
come dimostra il fatto che sono le normative stesse
ad indicare il costruttore del sistema quale esecutore
responsabile del test. Nella Figura 1, è riportata una
immagine di una prova ottenuta applicando questa procedura
durante la caratterizzazione del sistema usato da Ansaldo
Energia S.p.A., con cui IIS sta attivamente collaborando a
tal proposito. Il metodo del blocco a gradini, di più rapida
esecuzione, è ritenuto attuabile sia dai costruttori sia da
utilizzatori definiti “enhanced users”, ovvero in grado
di poter disporre di laboratori ed attrezzature specifiche;
Figura 1 – Misurazione di SNR con il Metodo dell’esposizione a step: serie di esposizioni realizzate con tensione e corrente costanti e aumento
del tempo di esposizione (Cortesia Ansaldo Energia S.p.A.)
644
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
65XVFD5DGLRJUDÀD'LJLWDOH&DUDWWHUL]]D]LRQHGHLVLVWHPL&5SHUDSSOLFD]LRQLLQGXVWULDOL
seguendo questa procedura, inoltre, l’utilizzatore può anche
ottenere informazioni circa la sensibilità in contrasto, ovvero
il parametro che può essere considerato indice della visibilità
delle imperfezioni.
A questo scopo particolarmente idoneo è il terzo metodo
sopra elencato, il quale anche nelle normative europee è
affrontato e strutturato seguendo le prescrizioni di standard
ASTM; dato l’approccio decisamente operativo di questa
metodica, tipico dei codici e delle normative statunitensi,
la procedura relativa è ritenuta applicabile non solo dai
costruttori ma anche dagli utilizzatori senza particolari
restrizioni.
Misurazione del Grey Value - GV
Dal momento che la misurazione di SNR non è agevole e
considerando che SNR e GV sono strettamente correlati
(SNR opportunamente normalizzato è funzione crescente
di GV), è possibile ricavare il minimo valore di SNR dal
minimo valore di GV, il quale rappresenta invece un
parametro più immediato e riconducibile al concetto di
“densità ottica” delle tecniche tradizionali a film. Sebbene
GV, come detto, costituisca un parametro concettualmente
più comprensibile, operativamente più immediato e
quantitativamente più indicativo della capacità di un sistema
CR di rilevare imperfezioni, la sua valutazione è compito
che viene attribuito dai riferimenti normativi al costruttore.
Tuttavia, è importante notare che, rispetto a quanto indicato
nella norma UNI EN 14784, datata 2006, attualmente i
software, di cui le workstation CR sono fornite, permettono
di calcolare SNR senza eccessiva difficoltà; ciononostante
GV rimane parametro di particolare rilievo quando non è
possibile o non è agevole identificare zone omogenee in cui
definire la ROI, condizione, questa, assolutamente necessaria
per ottenere valori di SNR attendibili.
Determinazione della Risoluzione Spaziale
Successivo parametro da valutare in fase di caratterizzazione
dei sistemi CR è la risoluzione spaziale che, a differenza
di quanto accade nel caso dei sistemi tradizionali a film,
non è quantitativamente determinata esclusivamente dalla
penombra geometrica ma anche da fattori “intriseci” del
sistema, i quali contribuiscono alla non nitidezza totale
dell’immagine. Per una maggiore comprensione, anche
dei riferimenti vigenti in materia, sono elencati di seguito
i termini, le abbreviazioni e le definizioni delle grandezze
sopra citate:
r
r
indice della non nitidezza dell’immagine dovuta a fattori
geometrici (distanza fuoco film, spessore dell’oggetto
in esame…) e alla dimensione fisica della sorgente
radiogena;
Inherent Un-Sharpness (UI): non nitidezza intrinseca
del sistema CR, legata a fattori costruttivi del sistema
quali, ad esempio, la dimensione della grana degli IP, la
dimensione dello spot del laser dello scanner, la velocità
di scansione;
Total Un-Sharpness (UTOT): non nitidezza complessiva
dell’immagine, è calcolabile dalla seguente relazione
UTOT = (Ug3 + UI3)1/3 ed è pari a 2SRb.
Dal momento che la non nitidezza complessiva
dell’immagine dipende fortemente dalla qualità della
radiazione, ossia dalla sua energia, la sua misurazione deve
essere condotta in almeno due differenti condizioni: a tal
proposito i riferimenti normativi individuano un primo set
di parametri, nel caso si debba operare in applicazioni in
cui servano radiazioni molto dure (ad esempio, controlli
di forti spessori e/o di materiali caratterizzati da elevato
assorbimento radiografico), e un secondo set, nel caso le
applicazioni di interesse siano associate a radiazioni molli
(ad esempio, controlli di spessori sottili, di materiali non
metallici, di componentistica elettronica).
In termini operativi, esistono tre differenti procedure per la
valutazione di UTOT: la prima, più complessa, a carico del
costruttore del sistema, è basata sul calcolo di un parametro
noto come MTF (Magnitude of the Fourier-Transform) e
può sfruttare alcuni indicatori presenti nel CR Phantom;
le altre due, invece, più agevoli sebbene anch’esse di non
immediata attuazione, sfruttano gli IQI a doppio filo o gli
indicatori a linee convergenti (entrambi sono indicatori noti
e adottati storicamente per certe verifiche nelle tecniche a
film) e possono essere eseguite anche dagli utilizzatori.
In tutti e tre i casi, vale la pena osservare che le condizioni
di prova devono essere tali da garantire il minimo contributo
possibile di Ug a UTOT: infatti, in considerazione del fatto che
l’obiettivo della verifica è caratterizzare le prestazioni del
sistema in termini di risoluzione e definizione dell’immagine,
è necessario fare in modo che i contributi esterni (ad esempio,
quelli legati alle condizioni geometriche) siano trascurabili.
A tal proposito, significative sono le prescrizioni riguardanti
l’utilizzo di sorgenti radiogene con spot size inferiore a 1 mm
e l’adozione di distanze fuoco-film pari almeno ad 1 m al fine
di ridurre il contributo di Ug a valori inferiori al 10% della non
nitidezza totale dell’immagine.
Verifiche Addizionali
r
r
Basic Saptial Resolution (SRb): massima risoluzione
spaziale del sistema, ovvero massima capacità del
sistema di “risolvere” piccoli dettagli a breve distanza
fra loro e quindi inversamente proporzionale alla perdita
di definizione dell’immagine;
Geometric Un-Sharpness (Ug): penombra geometrica,
A completamento del quadro di verifiche e misurazioni volte
alla caratterizzazione dei sistemi CR, è opportuno segnalare
una serie di prove addizionali che permettono di ottenere
informazioni circa il corretto funzionamento dei dispositivi
hardware che sono alla base del processo di scansione,
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
645
65XVFD5DGLRJUDÀD'LJLWDOH&DUDWWHUL]]D]LRQHGHLVLVWHPL&5SHUDSSOLFD]LRQLLQGXVWULDOL
acquisizione ed elaborazione dell’immagine digitale.
Tali test possono essere condotti anche dagli utilizzatori ed
è loro interesse prevederle con una determinata frequenza
in modo da rilevare quanto prima eventuali anomalie;
ciononostante, come viene correttamente asserito anche
dalle normative vigenti, l’analisi e l’azione correttiva delle
anomalie rilevate dovranno comunque essere gestite dal
personale tecnico specializzato del costruttore.
Di seguito sono elencate le principali prove addizionali:
r
r
r
r
r
r
r
verifica delle distorsioni geometriche: verifica del
corretto trasporto in entrambe le direzioni del piano di
scorrimento dell’IP nello scanner durante la scansione;
verifica di funzionalità del fascio laser dello scanner:
verifica dell’integrità del laser, dell’assenza di fenomeni
di “jitter” del fascio, dell’assenza di dispersione del
segnale, della corretta focalizzazione del fascio;
verifica di fenomeni di “blooming/flare”: verifica
dell’assenza di zone sovraesposte a causa di fenomeni
di saturazione;
verifica di fenomeni di “slipping”: verifica dell’assenza
di fenomeni di scivolamento dell’IP durante la
scansione, possibile causa di differenza di GV in aree
uniformemente espsote;
verifica di fenomeni di “shading”: verifica dell’uniformità
di intensità del laser su tutta la larghezza di scansione e
del corretto allineamento dei fotomoltiplicatori, presenti
per l’amplificazione del segnale in uscita dai “fosfori”
scansionati;
verifica di corretta eliminazione dell’immagine:
verifica del corretto funzionamento del dispositivo di
cancellazione dell’immagine, necessaria ad evitare la
presenza di “ghost” sulle radiografie successive;
verifica della presenza di “artefact” sull’IP: verifica
Figura 2 - Phantom CR: set di indicatori di qualità mirati alla valutazione e al monitoraggio delle prestazioni di un sistema CR
646
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
r
dell’assenza di difetti sugli IP (paragonabili ai cosiddetti
“difetti film”, tipici delle pellicole tradizionali), possibili
cause di difficile o errata interpretazione delle immagini
digitali;
verifica del comportamento dell’IP: verifica della
linearità della risposta degli IP sia in valore assoluto
(variazioni di GV ottenuti in risposta proporzionali alle
variazioni dei parametri di esposizione), sia nel tempo
(valori costanti di GV ottenuti a parità di esposizione in
esposizioni successive).
Per le prove sopra citate gli utilizzatori possono servirsi dei
“phantom” specifici, di cui, nella Figura 2, è presentata la
tipologia proposta dalle normative europee ed internazionali:
6. ClassiÀcazione dei Sistemi CR
La classificazione dei sistemi CR, a fronte delle prove
descritte nei precedenti paragrafi, è basata sul minimo
valore di SNR e sul massimo valore di SRb; la tabella di
classificazione, in accordo alla norma europea di riferimento,
è riportata nella Figura 3.
Come si evince dalla Figura 3, a livello europeo, i sistemi
CR sono suddivisi in sei classi e la relativa designazione,
IP X/Y- è definita da due valori:
1.
2.
X: indice numerico variabile da 1 a 6 in funzione del
minimo valore di SNR ottenuto;
Y: valore ottenuto per la massima risoluzione spaziale
SRb.
A titolo di esempio, se un sistema CR è classificato IP2/80,
significa che esso è caratterizzato da SNR minimo pari a 117
e da SRb massima di 80 μm; a tal proposito, è fondamentale
tenere presente che SRb deve essere valutata sia in direzione
parallela alla direzione di scansione del laser, sia nella
direzione ad essa ortogonale: nel caso in cui si ottengano
risultati differenti, per ragioni cautelative, il valore da
Figura 3 - Classificazione dei Sistemi CR in funzione del minimo SNR,
in accordo a UNI EN 14784-1
65XVFD5DGLRJUDÀD'LJLWDOH&DUDWWHUL]]D]LRQHGHLVLVWHPL&5SHUDSSOLFD]LRQLLQGXVWULDOL
assumere come rappresentativo delle prestazioni del sistema
CR in studio deve essere il maggiore dei due.
A valle di quanto sopra descritto, è opportuno fare
alcune precisazioni: innanzi tutto, la classificazione del
sistema, sebbene non ne tenga traccia esplicitamente nella
designazione, non deve prescindere dal soddisfacimento
degli altri requisiti (ovvero dei risultati di tutte le altre
prove di caratterizzazione), che dovranno essere verificati
e mantenuti nel tempo; inoltre, aspetto questo ancora
più rilevante, è necessario considerare che lo stesso IP (o
sistema CR) può soddisfare i requisiti di tutte le sei classi
previste, a seconda delle differenti condizioni operative di
utilizzo. Ciò è dovuto alla maggiore ampiezza del range
dinamico che contraddistingue un sistema CR rispetto ad un
sistema tradizionale a film: questo significa che, a differenza
di una pellicola tradizionale la quale può appartenere ad una
sola classe (UNI EN 584-1), lo stesso IP può, ad esempio,
rientrare in classe 6 (UNI EN 14784-1) se esposto per breve
tempo con alte energie, compensando tramite una scansione
ad elevato livello di amplificazione (gain) elettronica,
oppure può rientrare in classe 1 (UNI EN 14784-1) se
esposto con tempi di esposizione maggiori, energie minori
e se scansionato con minori livelli di amplificazione da
parte dello scanner. In ultima analisi, la motivazione di
questa differenza di comportamento tra tecniche CR e
tecniche tradizionali può essere ricercata nella differenza
dell’andamento delle curve sensitometriche degli IP rispetto
a quello delle curve delle pellicole: le prime sono lineari e
caratterizzate da bassa pendenza, le seconde, invece, dopo
un tratto pressoché costante, crescono rapidamente ed è
proprio in tale zona, caratterizzata da elevata pendenza ma
anche da breve estensione, che i film devono essere utilizzati,
dal momento che questo andamento corrisponde ad una
loro risposta molto “contrastata” quando opportunamente
esposti. Infine, completa la classificazione di un sistema
CR un ultimo parametro, noto con la designazione “CEN
Speed”, la cui misurazione è a carico dei costruttori: esso
rappresenta la velocità di risposta, espressa in termini di dose
radiografica assorbita (misurata in gray – Gy), necessaria per
ottenere un determinato valore di GV su un IP appartenente
ad una determinata classe X.
sensibilità imposta nelle differenti applicazioni.
In generale, prove successive alla caratterizzazione
iniziale devono comunque essere fatte, o dal costruttore o
dall’utilizzatore (nel caso non siano troppo gravose), ogni
volta che si presentino le seguenti situazioni:
r
r
r
r
Scopo di queste prove è ovviamente accertarsi che le
variazioni apportate e/o gli inserimenti fatti non abbiano
compromesso il livello qualitativo che caratterizzava le
prestazioni del sistema in precedenza.
Per quanto concerne, invece, il monitoraggio delle
caratteristiche di un sistema CR nel tempo, a prescindere
dall’effettuazione di modifiche, è necessario definire innanzi
tutto la frequenza temporale che si intende adottare, la scelta
dipende dai seguenti fattori:
r
r
r
r
r
grado di utilizzo del sistema;
condizioni operative ed ambientali in cui il sistema
lavora;
indicazioni fornite dal costruttore;
criticità delle applicazioni a cui il sistema è dedicato
(anche piccole variazioni possono essere determinanti
se la sensibilità richiesta è molto alta);
accordi fra le parti (esigenze e/o richieste particolari del
cliente).
Le principali verifiche che devono essere fatte riguardano i
seguenti parametri:
r
r
7. VeriÀca della Stabilità a Lungo Termine dei
Sistemi CR
r
La caratterizzazione e la successiva classificazione di
un sistema CR rappresentano condizioni indispensabili
per introdurre il sistema stesso in ambito industriale ed
utilizzarlo in modo affidabile e con la consapevolezza da
parte dell’utilizzatore dei suoi pregi e dei suoi limiti.
A questa fase iniziale devono essere associate le fasi,
altrettanto importanti, di monitoraggio delle prestazioni nel
tempo per rilevare e quantificare eventuali variazioni della
qualità delle immagini digitali ottenute durante le ispezioni,
in modo da essere sempre in grado di poter rispettare la
modifiche dell’hardware;
riparazioni e adeguamenti dello scanner;
aggiornamenti dei software;
introduzione di nuovi IP.
r
r
r
r
SRb: valutata o tramite indicatore “duplex wire” o
tramite indicatore a linee convergenti.
SNR: valutato mediante esposizioni su blocco a gradini
e con una periodicità ad esempio annuale; si tenga
presente a tal proposito che SNR può variare a seguito
dell’usura degli IP o dei fotomoltiplicatori del segnale
dello scanner; in generale, una sua riduzione è ammessa
non oltre un certo valore % rispetto al valore iniziale
mentre un suo aumento è accettato senza restrizioni, se
questo non comporta riduzioni di SRb.
Contrasto: valutato in base alla capacità di visualizzare
una percentuale del materiale in esame.
Slipping: valutato in termini di “sì/no”, ovvero con
prova qualitativa volta alla semplice rilevazione della
presenza del fenomeno.
Fluttuazioni (jitter): valutato anch’esso in termini di “sì/
no”.
Shading: valutato come percentuale ad una determinata
distanza.
Comportamento e stato degli IP: presenza di “artefact”,
presenza di “ghost” a seguito del processo di
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
647
65XVFD5DGLRJUDÀD'LJLWDOH&DUDWWHUL]]D]LRQHGHLVLVWHPL&5SHUDSSOLFD]LRQLLQGXVWULDOL
r
cancellazione delle immagini, linearità della risposta,
decadimento della risposta.
Fading: da verificare in linea di principio solo se vi è
stato un cambio di marca di scanner e/o di IP e non si
hanno dati tecnici in merito da parte del costruttore o
se il sistema in esame viene impiegato in condizioni
estreme di temperatura.
I parametri d’esposizione delle prove condotte devono essere
registrati e i relativi risultati devono essere opportunamente
documentati, così come la data di esecuzione e il nome del
tecnico qualificato che le ha eseguite.
8. Conclusioni
A conclusione di questa breve rassegna delle fasi principali
dell’iter di caratterizzazione dei sistemi CR, è possibile
fare alcune considerazioni, frutto delle esperienze che IIS
sta maturando in materia negli ultimi anni, derivanti non
solo dall’utilizzo del proprio sistema CR ma anche dalla
collaborazione con importanti realtà industriali italiane che
hanno introdotto la radiografia computerizzata fra i loro
metodi di indagine. La caratterizzazione di un sistema CR,
così come di ogni altra tecnologia (specie se innovativa),
è processo indispensabile al fine di conoscerne le reali
potenzialità e risulta altresì importante avere il supporto
di riferimenti normativi nazionali ed internazionali per
garantire un iter unificato che consenta anche il confronto
fra differenti sistemi, testati in differenti laboratori. Ciò
tuttavia non significa che la conduzione di tutte le prove
proposte a livello normativo sia fattibile dagli utilizzatori
senza sovraccarichi in termini sia economici, sia di
attrezzatura necessaria, sia di tempi di esecuzione. Nel
caso specifico della radiografia computerizzata, esempio
evidente è rappresentato dalla misurazione di SRb mediante
gli IQI a doppio filo (“duplex wire”) in cui vengono
richieste macchine radiogene con macchie focali inferiori a
1 mm, valore non caratteristico delle macchine radiogene
tipicamente usate dall’industria, e distanze fuoco-film
di almeno 1 m, valore che implica tempi di esposizione
spesso incompatibili con le tempistiche industriali; un altro
esempio importante è costituito dai “phantom”, spesso citati
anche in questo articolo: essi sono molto costosi e hanno
peraltro il limite di essere significativi solo per caratterizzare
i sistemi ma non per validare tecniche, dal momento che
non sono affatto sostitutivi di RQI (“Representative Quality
Indicator”), ovvero di blocchi di campione opportunamente
difettati, rappresentativi dell’oggetto in esame.
Per tenere conto delle problematiche suddette, molte delle
prove proposte sono in effetti ritenute compito dei costruttori
ma di fatto spesso ciò non si verifica perché i riferimenti
normativi in vigore non sono noti o non sono tenuti in debita
considerazione. Nel caso in cui i costruttori si facciano
realmente carico delle prove, non va comunque trascurato
648
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
Figura 4 - Esempio di contrastimetro (ASTM E 1647-98a): lo spessore T
dell’indicatore varia in funzione del materiale radiografato
che il costo che deriva dal rilascio della certificazione
conseguente si rivela anch’esso molto elevato. Particolare
interesse merita inoltre la competenza richiesta al personale
addetto all’utilizzo di tali tecnologie: specie nelle fasi di
caratterizzazione e nell’interpretazione dei relativi risultati, il
tecnico radiologo dovrebbe possedere adeguata conoscenza
e sufficiente esperienza anche nel campo dell’elettronica
e dell’informatica, condizione questa che non sempre
si verifica e che, nel caso si verifichi, non può comunque
prescindere dall’intervento di tecnici specializzati del
costruttore per manutenzioni, per la risoluzione di problemi
software e/o hardware, per la comprensione di errati
funzionamenti di qualche componente. Allo stato dell’arte
attuale, la sinergia fra utilizzatori e costruttori è fondamentale
per una consapevole ed affidabile introduzione dei sistemi
CR nell’industria: a tal proposito, è importante segnalare
che per il calcolo di parametri essenziali, quali ad esempio
SNR e SRb, gli sviluppi a livello di software negli ultimi
mesi sono stati molto incoraggianti sebbene non ancora
totalmente risolutivi. Recenti sviluppi e modifiche a favore
degli utilizzatori riguardano inoltre alcuni requisiti previsti
dalle nuove edizioni delle norme EN 14784, ISO 16371 e
ISO 17636, che ne hanno infatti ridotto la severità:
r nel caso si debba operare sia in classe A sia in classe B
(anche nella tecnologia CR è prevista la suddivisione
in Classe A e Classe B storicamente presente nella
radiografia tradizionale in accordo a EN 444), a parità
di spessori radiografati, si possono accettare valori di
SRb peggiori (valutati con il metodo dell’IQI a doppio
filo);
r parametri quali SNR, SRb e, in linea di principio, quelli
derivanti da prove basate sull’utilizzo di IQI a doppio
filo ed altri indicatori quali ad esempio i contrastimetri
(Fig. 4), possono sostituire i risultati di procedure ed
65XVFD5DGLRJUDÀD'LJLWDOH&DUDWWHUL]]D]LRQHGHLVLVWHPL&5SHUDSSOLFD]LRQLLQGXVWULDOL
algoritmi di calcolo lunghi ed artificiosi indicati nelle
precedenti edizioni per la valutazione di prestazioni
ed output del sistema, quali il cosiddetto “read-out
intensity”.
Infine, è necessario prestare attenzione al fatto che
gli standard esistenti in materia, sebbene possano
rappresentare un grande supporto per gli utilizzatori e per
i costruttori, se correttamente applicati, non sono tuttavia
esaustivi o, almeno, non lo sono nelle parti relative alla
caratterizzazione del sistema: ad esempio, non vengono
fornite specifiche indicazioni o indicati requisiti minimi
di componenti hardware quali la workstation o il monitor;
circa quest’ultimo, per esempio, è necessario ricorrere ad
altri riferimenti (tipicamente norme di prodotto) per ottenere
informazioni sulle prestazioni minime richieste, quali:
r
r
r
r
luminanza minima (espressa in cd/m2);
risoluzione minima;
dimensione massima del pixel;
range minimo di “grigi”;
r
r
rapporto minimo fra luminanza massima e luminanza
minima fornite;
setup tramite immagini di prova.
Alla luce di quanto sopra esposto, appare evidente che
molti sono ancora gli aspetti che devono essere affrontati
ed approfonditi da parte degli utilizzatori, dei costruttori
ma anche degli organi preposti alla standardizzazione, i
quali hanno l’importante compito di redigere documenti
che riescano a conciliare il rigore tecnico-scientifico con le
esigenze di campo e le oggettive difficoltà operative che si
incontrano nell’applicazione a livello industriale di nuove
tecnologie. Senza dubbio, l’attività di sperimentazione
svolta finora ha portato a risultati positivi e ad una buona
consapevolezza delle prestazioni dei sistemi CR; una
volta consolidate queste conoscenze e questa fase di
caratterizzazione, il passo successivo è rappresentato
dalla messa a punto delle tecniche, dal setup dei sistemi
in specifiche applicazioni di interesse industriale e dalla
conseguente stesura delle relative procedure di controllo.
BibliograÀa
[1] UNI EN 14784-1:2006 “Prove non distruttive - Radiografia industriale computerizzata mediante l’impiego di
schermi ai fosfori - Parte 1: Classificazione dei sistemi”
[2] UNI EN 14784-2:2006 “Prove non distruttive - Radiografia industriale computerizzata mediante l’impiego di
schermi ai fosfori - Parte 2: Principi generali per l’esame dei materiali metallici utilizzando raggi X e raggi
gamma”
[3] ISO 16371-1:2011 “Non-destructive testing - Industrial computed radiography with storage phosphor imaging
plates - Part 1: Classification of systems”
Simone RUSCA, laureato in ingegneria meccanica nel Febbraio 2002 presso l’Università degli Studi di Genova,
International Welding Inspector - Comprehensive dal 2005, Livello 3 EN 473 / ISO 9712 nei metodi VT, MT, PT, RT,
LT, ricopre il ruolo di Responsabile del Centro Esame IIS del Personale addetto alle Prove non Distruttive dal 2006 e di
Responsabile dell’Area Formazione Controlli non Distruttivi dal 2009. In forza alla Divisione Formazione dell’Istituto
Italiano della Saldatura dal Settembre 2002, svolge attività di docenza nell’ambito delle Prove non Distruttive e
dell’Ispezione dei Giunti saldati e attività di sviluppo e set-up di tecnologie innovative nel campo delle Prove non
Distruttive, quali la Radiografia Computerizzata.
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
649
“Cerchiamo di rendere migliore il vostro lavoro e la vostra vita.”
DELVIGO COMMERCIALE Supporti ceramici per la saldatura
MATAIR Forni, aspirazione e riciclaggio dei Áussi
CETh, trattamenti termici
Loc. Cerri, 19020 Ceparana di Follo SP
Tel. 0187931202; Fax 0187939094; E-mail [email protected]; www.delvigo.com
4XDOLÀFD]LRQHGHOSURFHVVRGL
SODFFDWXUDQRUPDWLYDDSSOLFDELOH
A. Pandolfo *
Sommario6XPPDU\
Nel mondo della fabbricazione delle costruzioni di apparecchi in pressione, reattori, valvole e tubazioni il processo
di placcatura interna mediante saldatura rappresenta molto
spesso uno degli aspetti più critici e delicati.
Il controllo dei parametri che influenzano le caratteristiche della placcatura, si esegue, come per le altre saldature, attraverso l’uso di specifiche di procedura di saldatura
(WPS), necessarie per fornire una base ben definita per la
programmazione delle attività di saldatura.
La preparazione di una specifica di procedura di saldatura
fornisce la base necessaria, ma non garantisce di per sé che
le saldature rispondano ai requisiti richiesti.
Alcune irregolarità operative e la composizione chimica
del placcato, possono essere valutate mediante metodi non
distruttivi o semidistruttivi sul prodotto finito, mentre le
eventuali deviazioni metallurgiche, costituiscono un problema, in quanto non è possibile rilevarle con metodi non
distruttivi. Questi aspetti richiedono pertanto un opportuno
controllo della qualità, prima e durante la saldatura, di cui
sono elementi fondamentali la qualificazione delle procedure di saldatura.
Weld overlay is one of the most critical welding processes
for pressure vessels, reactors, valves and pipelines construction. Welding parameters control, influencing mechanical properties of weld metals, is obtained - as well
as other welding processes - through the use of welding
procedure specification (WPS), necessary to provide a
welding operations plan. Production of welding procedure
specification is a basic factor, but it is not enough to ensure
welded joints requirements.
Some defects and chemical compositions of clad metals
can be evaluated by nondestructive methods while it is not
possible to check metallurgical imperfections with non-destructive methods. These factors require a proper quality
control, before and during overlay welding, essential for
qualification of welding procedures.
IIW Thesaurus Keywords:
Building up by welding; buttering; cladding; hardfacing;
metallography; nondestructive testing; process qualification; standards; test pieces; ultrasonic testing; visual inspection.
(°) Memoria presentata al Convegno IIS: “La placcatura nella fabbricazione di
apparecchiature in pressione” - Genova, 10 Novembre 2011
* IIS Cert dell’Istituto Italiano della Saldatura - Genova
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
651
$3DQGROIR4XDOLÀFD]LRQHGHOSURFHVVRGLSODFFDWXUDQRUPDWLYDDSSOLFDELOH
r
1. Le normative
Il parco normativo relativo al mondo della saldatura è assai vasto; per semplificare, le norme che in qualche misura
contribuiscono a standardizzare gli aspetti connessi con la
saldatura, possono essere suddivise in due grandi gruppi:
r norme di fabbricazione di specifici prodotti per i quali la
saldatura rappresenta comunque un aspetto importante;
r norme specificatamente e direttamente dedicate alla
saldatura, trasversali al prodotto (ad esempio le norme
relative ai requisiti di qualità in saldatura, ai materiali di
apporto, alla qualifica delle procedure di saldatura e dei
saldatori).
Gli enti normatori preposti alla redazione di norme tecniche
nel settore della saldatura (e non solo) sono l’UNI (in ambito
nazionale italiano), il CEN (in ambito europeo) e l’ISO (in
ambito internazionale).
L’UNI, oltre alla preparazione e pubblicazione di norme in
prima persona, deve recepire (in alcuni casi tradurre) e pubblicare le norme europee emanate dal CEN (Comitato Europeo di Normazione).
Le norme così recepite vengono identificate dalla sigla EN
preceduta da quella dell'ente di normazione nazionale, nel
caso dell'Italia UNI, della Germania DIN, dell'Inghilterra
BSI. Grazie agli accordi di collaborazione tra ISO e CEN, le
norme internazionali ISO esistenti, se ritenute soddisfacenti dal CEN, possono essere adottate da quest’ultimo come
norme europee e viceversa, dando luogo a norme EN ISO
che successivamente diventano, in ambito nazionale, norme
UNI EN ISO.
Negli ultimi anni la normativa sulle specifiche di procedura
di saldatura (WPS) è stata oggetto di un percorso di grande
rinnovamento.
L’aspetto più rilevante di tale percorso è che, con la norma
UNI EN ISO 15614-7, elaborata dal CEN nel settore della
certificazione delle procedure di riporti con saldatura, viene a colmarsi un vuoto normativo in ambito europeo, dal
momento che le norme della serie UNI EN ISO 15614 non
abbracciavano tutti i processi di saldatura, tutti i materiali
base più importanti e tutte le applicazioni.
Per la stesura delle WPS la serie delle norme UNI EN ISO
15609, suddivise per tipologia di processo, richiamate nella
suddetta norma sono la:
r UNI EN ISO 15609-1 - Specificazione e qualificazione delle procedure di saldatura per materiali metallici
- Specificazione della procedura di saldatura - Parte 1:
Saldatura ad arco;
r UNI EN ISO 15609-3 - Specificazione e qualificazione delle procedure di saldatura per materiali metallici
- Specificazione della procedura di saldatura - Parte 3:
Saldatura a fascio elettronico;
652
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
UNI EN ISO 15609-4 – Specificazione e qualificazione delle procedure di saldatura per materiali metallici
- Specificazione della procedura di saldatura - Parte 4:
Saldatura a fascio laser.
Per la qualificazione delle WPS le altre norme applicabili
richiamate sono:
r UNI EN ISO 15607 - Specificazione e qualificazione
delle procedure di saldatura per materiali metallici - Regole generali;
r UNI EN ISO 15614-7 - Specificazione e qualificazione delle procedure di saldatura per materiali metallici
- Prove di qualificazione della procedura di saldatura
- Parte 7: Riporti mediante saldatura;
r UNI EN ISO 15613 - Specificazione e qualificazione
delle procedure di saldatura per materiali metallici Qualificazione sulla base di prove di saldatura di preproduzione.
Altre norme pubblicate, che riguardano, direttamente o indirettamente, la placcatura mediante saldatura, sono le seguenti:
r UNI EN 1011-5 - Raccomandazioni per la saldatura di
materiali metallici - Parte 5: Saldatura degli acciai placcati;
r UNI EN ISO 9692-4 - Saldatura e procedimenti connessi - Raccomandazioni per la preparazione dei giunti
- Parte 4: Acciai placcati.
Le principali norme americane nel settore della certificazione delle procedure di saldatura mediante placcatura
sono l’ASME Boiler & Pressure Vessel Code, Sezione IX e
Sezione VIII, Divisione 1 e 2.
2. La TualiÀcazione delle procedure di saldatura
2.1 La procedura di saldatura (WPS)
Gli aspetti fondamentali che influenzano le caratteristiche
finali di una placcatura sono:
r imperfezioni operative: legate alle capacità operative
del saldatore/operatore di saldatura;
r imperfezioni metallurgiche: legate alla metallurgia della saldatura e quindi direttamente dipendenti dai parametri di saldatura.
Questi aspetti richiedono pertanto un opportuno controllo
della qualità prima e durante la saldatura, di cui sono elementi fondamentali la qualifica dei processi di saldatura e
la certificazione dei saldatori e degli operatori di saldatura.
Il controllo dei parametri che influenzano le caratteristiche
del giunto, si esegue attraverso l’uso di specifiche di procedura di saldatura (WPS), necessarie per fornire una base ben
definita per la programmazione delle attività di saldatura e
per il controllo della qualità durante la saldatura.
La preparazione di una specifica di procedura di saldatura
fornisce la base necessaria, ma non garantisce di per sé che
le saldature rispondano ai requisiti richiesti. Alcune irregolarità, in particolare imperfezioni operative, possono essere
valutate mediante metodi non distruttivi sul prodotto finito.
Le deviazioni metallurgiche costituiscono comunque un
problema importante, in quanto la loro valutazione non è
$3DQGROIR4XDOLÀFD]LRQHGHOSURFHVVRGLSODFFDWXUDQRUPDWLYDDSSOLFDELOH
possibile con metodi non distruttivi. La WPS deve fornire
tutti i dettagli per la corretta esecuzione della saldatura, deve
garantire la ripetibilità del risultato e inoltre rappresenta il
know-how del costruttore. Le norme definiscono i contenuti tecnici delle specifiche di saldatura (WPS) e le modalità
con le quali qualificarle mediante esami e prove, finalizzati
a verificare la fusione tra il riporto di saldatura e il materiale di base e garantire un adeguato deposito di materiale di
placcatura, con caratteristiche anticorrosive. Allo scopo di
qualificare una procedura di saldatura di placcatura è necessario predisporre una WPS preliminare (pWPS) - in conformità alle relative parti delle norme applicabili UNI EN ISO
15609 o ASME Sezione IX, eventualmente integrate con altre specifiche contrattuali - nella quale devono essere specificati tutti i parametri inerenti l’attività di saldatura e devono
essere descritte tutte le informazioni necessarie all’esecuzione del saggio di prova.
2.2 Prove di qualificazione della procedura di saldatura
(WPQR) secondo la normativa UNI EN ISO 15614-7 Specificazione e qualificazione delle procedure di
saldatura per materiali metallici - Prove di qualificazione della procedura di saldatura - Parte 7: Riporti
mediante saldatura
La norma di certificazione UNI EN ISO 15614-7 si riferisce alla saldatura di placcatura, ovunque tale processo venga
applicato. Si adattano alle diverse caratteristiche di qualità,
sicurezza e campo di applicazione dei vari prodotti (reattori,
valvole, tubazioni ecc…).
L’uso di un metodo particolare di qualificazione è spesso
un requisito obbligatorio di una norma di applicazione o in
assenza di tale requisito il metodo di qualificazione deve essere concordato tra le parti contraenti allo stato di offerta o
di ordine.
La norma riguarda, come abbiamo detto, la qualificazione
delle procedure di riporti di saldatura, mediante l’esecuzione
di saggi di prova rappresentativi. In tale norma sono descritte le modalità con le quali una specifica di saldatura viene
qualificata; in particolare vengono definiti:
r Saggi di prova;
r Esami e prove (da eseguire sui talloni di prova);
r Campi di validità.
La norma si applica a tutti i processi utilizzati per riporti
superficiali di saldatura:
r Riporto superficiale con saldatura (Overlay Welding);
r Placcatura (Cladding) - Riporto superficiale con saldatura usato per migliorare la resistenza alla corrosione e
al calore;
r Riporto duro (Hardfacing) - Riporto con saldatura usato
per migliorare la resistenza all’abrasione e all’urto.
La norma non si applica per:
r L’imburratura (Buttering) - Riporto superficiale con saldatura su un materiale per la transizione tra due metalli
dissimili;
r Build up - Riporto superficiale con saldatura per ripristinare le dimensioni di materiali simili.
Figura 1 - Saggio di prova - Lamiera
Figura 2 - Saggio di prova - Tubo
2.2.1 Saggi di prova
I saggi di prova devono essere realizzati in conformità con
la pWPS, devono avere una configurazione geometrica che
rispetti i requisiti di cui ai saggi standard e una lunghezza
(o il numero dei pezzi) sufficiente per ricavare tutte le prove
richieste (Figg. 1 e 2). Il tipo di materiale base, lo spessore
e il diametro devono essere scelti in funzione del campo di
validità.
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
653
$3DQGROIR4XDOLÀFD]LRQHGHOSURFHVVRGLSODFFDWXUDQRUPDWLYDDSSOLFDELOH
Figura 3 - Controlli e prove sui saggi
Devono essere eseguiti almeno tre cordoni per ogni strato e
se lo strato di sottofondo è usato in produzione, deve essere
usato anche nel saggio di prova.
2.2.2 Esami e prove
Per la qualificazione di una procedura di saldatura, il saggio
di prova deve soddisfare i requisiti di Figura 3.
Tutte le prove non distruttive devono essere eseguite sui saggi di prova prima del prelievo dei provini.
Eventuali trattamenti termici dopo la saldatura devono essere completati prima delle prove non distruttive.
I “NDT” devono essere eseguiti in accordo alla UNI EN ISO
17637 (esame visivo), UNI EN ISO 3452 (liquidi penetranti)
e UNI EN ISO 17640 (esame ultrasonoro).
Una procedura di saldatura è qualificata se le imperfezioni
nel saggio di prova rientrano nei seguenti limiti:
1. Con l’esame visivo e l’esame di superficie:
r non sono ammessi difetti planari e cricche;
r non sono ammesse porosità individuali > 2 mm.
2. Con l’esame ultrasonoro non sono ammesse indicazioni, provenienti da imperfezioni, superiori a quelle ottenute da un foro a fondo piatto di diametro 8 mm.
I provini per l’esame macroscopico devono essere preparati
ed esaminati in conformità alla UNI EN ISO 17639.
654
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
Figura 4 - Prove di durezza
L’esame macrografico deve includere la linea di fusione, la
ZTA e la costruzione degli strati.
Quando richiesto l’esame micrografico, la fotografia deve
includere il materiale di base e la linea di fusione (ZTA).
Le imperfezioni con l’esame macrografico devono rientrare
nei seguenti limiti:
r non sono ammessi difetti planari e cricche;
r non sono ammesse porosità individuali > 2 mm.
La prova di durezza HV10 o HV5 deve essere eseguita in
conformità alla UNI EN ISO 9015-1, le misurazioni di durezza devono essere effettuate su una linea inclinata di 15°
nella saldatura, nel metallo base e nella zona termicamente
alterata (Fig. 4).
$3DQGROIR4XDOLÀFD]LRQHGHOSURFHVVRGLSODFFDWXUDQRUPDWLYDDSSOLFDELOH
Figura 5 - Valori di durezza
I valori di durezza non devono eccedere i valori riportati nella Figura 5. I provini e l’esecuzione della prova di piegamento devono essere conformi alla UNI EN ISO 5173.
Il diametro del mandrino o rullo di piegamento deve essere
pari a 4 t e l’angolo di piegamento deve essere di 120° per un
metallo base avente un allungamento A ≥ 20%.
Per un metallo base avente un allungamento A < 20% si
deve applicare la formula seguente:
d = diametro del mandrino;
ts = spessore del provino;
A = allungamento %.
Durante la prova, i provini non devono rivelare alcun difetto singolo di lunghezza > 3 mm in ogni direzione (i difetti
che si rilevano in corrispondenza degli spigoli di un provino
durante la prova devono essere trascurati nella valutazione).
Per il riporto anticorrosivo dovrà essere determinata l’analisi
chimica del riporto di saldatura in accordo con la norma di
applicazione o della specifica di riferimento.
Se, in produzione, il riporto anticorrosivo deve essere lavorato di macchina, allora un’analisi chimica addizionale dovrà essere eseguita sul minimo spessore dopo lavorazione di
macchina (Fig. 6). Quando richiesto, il contenuto di ferrite
deve essere determinato in accordo con le specifiche di riferimento. Una norma di applicazione può specificare prove
addizionali, per esempio prove di corrosione.
2.2.3 Campo di validità
Ogni cambiamento al di fuori dei limiti di validità specificati richiede l’esecuzione di una nuova prova di procedura
di saldatura. La qualificazione di una determinata WPS deve
ritenersi valida quando la stessa venga utilizzata sotto il controllo tecnico e della qualità dello stesso costruttore.
Materiali base, spessore e diametro
La validità è limitata a materiali dello stesso grado di quelli
Figura 6 - Analisi chimica
adoperati per le prove; di fatto, vale il principio del raggruppamento dei materiali suddivisi per gruppi, già collaudato
con le norme EN di prodotto, reso poi univoco per le norme
europee impiegate per la qualificazione dei procedimenti
e dei saldatori/operatori mediante l’impiego della ISO/TR
15608. Per gli acciai si vedano le estensioni di validità delle
Figure 7 e 8.
La qualificazione di una prova di procedura di saldatura per
tubi < 150 mm deve essere eseguita su un tubo.
La qualificazione di una prova di procedura di saldatura eseguita su un diametro D è valida per tutti i diametri > 0,75.
Procedimento
La qualificazione è valida solo per il(i) procedimento(i) di
saldatura utilizzato(i) nella prova di procedura di saldatura.
La qualificazione è valida solo per la tecnica utilizzata (ad
esempio con oscillazione) utilizzata nella prova di procedura di saldatura.
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
655
$3DQGROIR4XDOLÀFD]LRQHGHOSURFHVVRGLSODFFDWXUDQRUPDWLYDDSSOLFDELOH
Apporto termico
La qualificazione vale, per tutti
gli strati, fino a un massimo del
- 10% + 25% oltre il valore registrato durante la prova di procedura di saldatura.
Figure 7 - Campo di qualifica per gli acciai
Figure 8 - Campo di qualifica per gli spessori
Materiale d’apporto
I materiali d’apporto coprono altri metalli d’apporto purché
essi abbiano caratteristiche meccaniche equivalenti, lo stesso tipo di rivestimento o di flusso, la stessa composizione
chimica nominale ed un tenore di idrogeno minore o uguale
secondo la designazione nella norma appropriata per il metallo d’apporto in questione.
Spessore depositato
Per il riporto anticorrosivo, quando la placcatura deve essere lavorata di macchina, (una prova addizionale di analisi
chimica deve essere eseguita sulla superficie finale lavorata)
e il minimo deposito qualificato è lo spessore provato con
analisi chimica.
Posizione di saldatura
La qualificazione vale per la posizione di saldatura utilizzata
nella prova di procedura di saldatura.
Comunque la posizione PC qualifica anche le posizioni PA
e PB.
Tipo di corrente
La qualificazione vale per il tipo di corrente [corrente alternata (c.a.), corrente continua (c.c.), corrente pulsante] e per
la polarità utilizzata nella prova di procedura di saldatura.
656
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
Preriscaldo e interpass
Quando è richiesto il preriscaldo,
il limite inferiore della qualificazione ottenuta è la temperatura
di preriscaldo nominale applicata
all’inizio della prova di procedura
di saldatura, per ciascun strato.
Il limite superiore della qualificazione ottenuta è la massima temperatura nominale fra le passate
raggiunta nella prova di procedura di saldatura.
Trattamento termico
Non è ammesso togliere il post-riscaldo. Non è ammesso aggiungere o togliere il PWHT. Il campo di temperatura qualificato è la temperatura di mantenimento, ± 20 °C, applicata
nella prova di procedura di saldatura, se non diversamente
specificato. Qualora sia richiesto, le velocità di riscaldamento, le velocità di raffreddamento ed il tempo di mantenimento devono essere messi in relazione con il componente di
produzione.
Numero degli strati per il riporto anticorrosivo
Il deposito con tecnica a strato singolo, qualifica anche la
tecnica a strati multipli. Il deposito con tecnica a strati multipli, non qualifica la tecnica a strato singolo.
Processo 111
La qualificazione ottenuta è valida per il diametro di elettrodo usato nella prova di procedura di saldatura, più o meno
un diametro di elettrodo per ciascuna passata, purché siano
soddisfatti i requisiti dell’apporto termico.
Processo 12 (Arco sommerso) e 72 (Elettroscoria)
La qualificazione ottenuta è limitata al sistema di filo elettrodo usato nella prova di procedura di saldatura (per esempio sistema a filo/nastro unico o a fili/nastri multipli).
La qualificazione ottenuta per il flusso in combinazione con
un filo/nastro è limitata alla marca ed alla classificazione
in accordo con la UNI EN ISO 14174 usata nella prova di
procedura di saldatura. La qualificazione ottenuta è limitata
a ogni dispositivo supplementare usato nella prova di procedura di saldatura (per esempio sistema di controllo del
campo magnetico, quando si usa il nastro o l’oscillazione
dell’elettrodo). La qualificazione ottenuta è limitata al diametro del filo o alla sezione del nastro usato nella prova di
procedura di saldatura.
$3DQGROIR4XDOLÀFD]LRQHGHOSURFHVVRGLSODFFDWXUDQRUPDWLYDDSSOLFDELOH
Processo 131, 135, 136, 137 e 141
La qualificazione ottenuta per il gas di protezione è limitata
al simbolo del gas secondo la UNI EN ISO 14175 usato nella prova di procedura di saldatura. La qualificazione ottenuta
è limitata al sistema di filo elettrodo usato nella prova di
procedura di saldatura (per esempio sistema a filo unico o a
fili multipli).
Processo 15 (Plasma)
In aggiunta a quanto richiesto per il 141 la qualificazione
ottenuta è limitata a:
r forma del filo usato;
r marca, sezione e tipo di polvere usato;
r velocità della polvere ± 10%;
r metodo di trasferimento (trasferito o non trasferito);
r diametro della torcia usato.
2.2.4 Verbale di Qualificazione (WPQR)
Il verbale di qualificazione di procedura di saldatura (WPQR)
costituisce un'attestazione dei risultati della valutazione di
Figura 9 - QW-453: campo di qualifica per gli spessori e prove
ciascun saggio di prova. Deve essere utilizzato un modulo
adeguato di WPQR per registrare i dettagli della procedura di saldatura ed i risultati dei controlli e delle prove, allo
scopo di facilitare in modo uniforme la presentazione e la
valutazione dei dati.
2.3
Prove di qualificazione della procedura di saldatura
(PQR) secondo Codice ASME Boiler & Pressure
Vessel Code, Sezione IX
2.3.1
Saggi di prova e tipi di prova
Le dimensioni dei saggi di prova, i campi di validità, gli esami e le prove richieste sono specificati in QW-214 - “Corrosion-Resistant Weld Metal Overlay” e in QW-453, (Fig. 9).
I saggi di prova, per la saldatura dei riporti, devono qualificare le gamme di spessori sia del metallo di base (T) che del
metallo di apporto depositato come overlay (t) da utilizzare
in produzione. I limiti della qualificazione devono essere
conformi al QW-453. Il metallo di base può essere costituito
da piastre, tubi o altre forme di prodotto.
Una prova su piastra è valida anche
per qualificare saldature di tubi e viceversa. Il tipo ed il numero di provini che devono essere sottoposti a prove per la qualificazione sono forniti
in QW-453 e devono essere estratti
in modo simile a quello illustrato in
QW-462 (Figg. 10-14).
Se un qualsiasi provino di prova richiesta da QW-453 non soddisfa i
criteri di accettazione applicabili, il
campione deve essere considerato
come difettoso ed uno nuovo deve
essere saldato. Le modalità di prova
e i criteri di accettabilità delle prove
meccaniche eseguite sui saggi saldati
per la qualificazione delle procedure
di saldatura sono definiti al QW-140
dell’Articolo I.
2.3.2 Limiti della qualificazione
Per ogni processo di saldatura tutte
le variabili essenziali e non essenziali elencate in QW-250 e definite
nell’Articolo IV del Codice ASME
Sezione IX (dati di saldatura), devono essere soddisfatte.
Ogni cambiamento al di fuori dei
limiti di validità specificati richiede
l’esecuzione di una nuova prova di
procedura di saldatura.
Come esempio è riportata nella Figura 15 la tabella delle variabili relative
al processo di saldatura SAW.
Nel QW-402, relativo al tipo di giunto
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
657
$3DQGROIR4XDOLÀFD]LRQHGHOSURFHVVRGLSODFFDWXUDQRUPDWLYDDSSOLFDELOH
Figura 10 - QW-462.5(b): Posizione macro per analisi chimiche
Figura 11- QW-462.5(c): Posizione prove di piega su tubi
Figura 13 - QW-462.5(e): Posizione prove macro e analisi chimiche
Figura 12 - QW-462.5(d): Posizione prove di piega su lamiere
per il processo SAW, la sola variabile essenziale riferita al
deposito di saldatura è:
r Lo spessore t.
Nel QW-403, relativo al tipo di metallo di base, ci sono due
variabili essenziali:
r Cambiare il P-No;
r Lo spessore T (Vedere Tabella QW-453).
Nel QW-404, relativo al tipo di metallo d’apporto, ci sono
tre variabili essenziali e una non essenziale (simbolo X sulle
rispettive colonne), di seguito si riportano le variabili:
658
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
Figura 14 QW-462.5(a): Posizione di prelievo dell’analisi chimiche
$3DQGROIR4XDOLÀFD]LRQHGHOSURFHVVRGLSODFFDWXUDQRUPDWLYDDSSOLFDELOH
Figura 15 - Variabili relative al processo SAW
r
Aumentare, diminuire o cambiare oltre il 10% la diluizione del filo supplementare;
r Cambiare l’A-No;
r Cambiare la composizione nominale del flusso.
Nel QW-405, relativo alla posizione, la variabile essenziale è:
r Cambiare la posizione di saldatura.
Nel QW-406, relativo al preriscaldo e all’interpass, le variabili essenziali sono:
r Il preriscaldo non si può ridurre di oltre 55 °C;
r L’interpass non si può aumentare.
Nel QW-407, relativo al trattamanto termico, la variabile essenziale è:
r Il tempo di trattamento.
Nel QW-409, relativo alle caratteristiche elettriche, ci sono
due variabili:
r Il cambio da AC in DC e viceversa; in DC il cambio
della polarità;
r Per il primo strato un incremento dell’apporto termico
di oltre il 10% .
Nel QW-410, relativo alla tecnica, ci sono tre variabili
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
659
$3DQGROIR4XDOLÀFD]LRQHGHOSURFHVVRGLSODFFDWXUDQRUPDWLYDDSSOLFDELOH
essenziali:
r Passare dalla tecnica a passate multiple alla tecnica a
passata singola;
r Togliere il dispositivo per il controllo magnetico del nastro;
r Cambiare il numero degli elettrodi;
e le seguenti non essenziali:
Cordoni tirati o oscillati, metodo di pulizia, oscillazione,
stick-out, distanza tra gli elettrodi, manuale/automatico e
martellatura.
Una WPS deve descrivere tutte le variabili essenziali e non
essenziali per ciascun processo di saldatura oggetto della
WPS. Queste variabili sono elencate per ogni processo nelle
Tabelle dal QW-252 al QW-265 e sono definite nell’Articolo
IV del Codice ASME, Sezione IX (dati di saldatura).
Possono essere fatte delle modifiche alle variabili non essenziali per adattarsi ad esigenze di produzione senza riqualificazione. Questo può essere fatto attraverso la correzione
della WPS o la redazione di una nuova WPS.
Modifiche al di fuori dei campi di validità delle variabili
essenziali impongono la riqualificazione della WPS (nuova
o aggiuntiva PQR per supportare la modifica alle variabili
essenziali).
3. Conclusioni
Le norme di certificazione, fatte le debite eccezioni, contengono una quantità rilevante di conoscenza condivisa e sono
rappresentative, pertanto, del livello tecnologico acquisito
nel settore di applicazione delle norme stesse.
Il tecnico di fabbricazione tende spesso a fare affidamento
principalmente sulla propria esperienza di lavoro ed a sottostimare le informazioni che possono essere tratte da un uso
intelligente della normativa, in continuo aggiornamento per
quanto riguarda tecnologia e materiali nei confronti delle
esigenze degli operatori del settore.
L’implementazione di un adeguato corpus normativo, infatti, non può che risultare di supporto a quella parte dell’industria nazionale che ha scelto la qualità come elemento caratterizzante la sua presenza sul mercato.
BibliograÀa
[1] UNI EN ISO 15614-7 Specificazione e qualificazione delle procedure di saldatura per materiali metallici Prove di qualificazione della procedura di saldatura - Part. 7: Riporti mediante saldatura.
[2] ASME Boiler & Pressure Vessel Code, Sezione IX & Sezione VIII Divisione 1 e 2.
Antonio PANDOLFO, diplomato Perito Meccanico Industriale nel 1974, è assunto all’Istituto Italiano della Saldatura
nel 1976 come Ispettore PND nel Settore Controlli Non Distruttivi. Livello 2 UNI EN 473 nei metodi UT, RT, MT, PT. E’
qualificato European/International Welding Technologist. Dal 1999 è Responsabile dell’Area Certificazione Procedure
e Saldatori dell’Istituto e attualmente ricopre la stessa funzione in IIS CERT.
660
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
Nuova Collana di CD Tecnici
Articoli scelti da Rivista Italiana della Saldatura
IIS Didattica 2011
‡
‡
‡
‡
‡
‡
Il processo di saldatura testa a testa con arco rotante costretto
magneticamente (MIAB - Magnetic Impelled Arc Butt Welding)
,QÁXHQ]DGHOOHLPSXUH]]HVXOSURÀORGLSHQHWUD]LRQHQHOODVDOGDWXUD7,*GL
acciai inossidabili austenitici: l’effetto Marangoni
I trattamenti a freddo dopo saldatura per la distensione ed il miglioramento
GHOOHSUHVWD]LRQLGHLJLXQWLVDOGDWL
,QWURGX]LRQHDOOHOHJKHDOOXPLQLROLWLRHGDOODORURVDOGDELOLWj
,QWURGX]LRQHDOODVDOGDWXUDFRQIDVFLRHOHWWURQLFR(%:HOGLQJ
/DFDUDWWHUL]]D]LRQHGHLJLXQWLVDOGDWLPHGLDQWHSURYHPHFFDQLFKH
Scienza e Tecnica 2011
‡
‡
‡
‡
‡
‡
7HFQLFKHG·LQGDJLQHXWLOL]]DWHQHOOD´IDLOXUHDQDO\VLVµ E. Ferrari
(YROX]LRQHGHJOLDFFLDLLQRVVLGDELOLSHUVFDPELDWRULGLFDORUHDIDVFLRWXELHUR
gli acciai superferritici - M. Murgia
1XRYDYLWDSHULO:5&UHYLVLRQHHLQQRYD]LRQHGHLFRQWHQXWLFRQOD
SXEEOLFD]LRQHGHO:5&G. L. Cosso
$SSOLFD]LRQHGHJOLDFFLDLLQRVVLGDELOLLQDFTXDGLPDUH - M. De Marco
*OLDFFLDLDXVWHQRIHUULWLFLLQLPSLHJKLVWUXWWXUDOLXQDUHFHQWHHVSHULHQ]DGL
YDOXWD]LRQHVSHULPHQWDOHGHOODUHVLVWHQ]DDIDWLFDGHLJLXQWLVDOGDWLM. Lanza
5HWURÀWWLQJ(QJLQHHULQJIRU)DWLJXH'DPDJHG6WHHO6WUXFWXUHVGDO*LDSSRQH
XQULIHULPHQWRLPSRUWDQWHSHUOHDWWLYLWjGLULSDUD]LRQHGHLGDQQHJJLDPHQWL
da fatica dei ponti metallici - S. Botta
Codice: 101509, € 30,00
Soci IIS - Membri IIS Club € 24,00
--------------------------------------------------------------------------------------
La placcatura nella fabbricazione di apparecchiature in
pressione
Genova, 10 Novembre 2011 - Atti del Convegno
‡
‡
‡
‡
‡
‡
Settore DDC
Maura Rodella
Lungobisagno Istria, 15
16141 GENOVA
Tel. 010 8341385
Fax 010 8367780
Email: [email protected]
www.weldinglibrary.com
www.iis.it
‡
‡
,OSURFHVVRGLSODFFDWXUDDGHOHWWURVFRULDDSSOLFD]LRQHHSULQFLSDOL
SUREOHPDWLFKHPHWDOOXUJLFKH - M. Mandina, A. Ottoboni / IIS Service;
M. Magnasco / GE Oil & Gas
6FHOWDGHLPDWHULDOLG·DSSRUWRLQIXQ]LRQHGHOOHVSHFLÀFKHWHFQLFKHHGHL
SURFHVVLXWLOL]]DWL- C. Casciaro, G. Gallazzi / ITW
/DSODFFDWXUDGHJOLDSSDUHFFKLDSUHVVLRQHSURFHGLPHQWLHGDSSOLFD]LRQL
F. Foroni, N. Maestri, M. Musti / Belleli Energy CPE
$SSOLFD]LRQHGHLSURFHVVL*0$:&07H7,*+RW:LUHSHUZHOGRYHUOD\
WHFQRORJLDHGDSSOLFD]LRQL - M. Grandi, L. Gennari / Arroweld Italia
3URFHVVRGLSODFFDWXUDDGHVSORVLRQHFDUDWWHULVWLFKHHGHVSHULHQ]HDSSOLFDWLYH
S. Pauly / Nobelclad-DMC
4XDOLÀFD]LRQHGHOSURFHVVRGLSODFFDWXUDQRUPDWLYDDSSOLFDELOH
A. Pandolfo / IIS Cert
&RQWUROORGHOODTXDOLWjGHOODSODFFDWXUDGLUHDWWRULSHUK\GURFUDFNLQJ
SURFHGXUHHFULWHULGLDFFHWWDELOLWjDSSOLFDELOL- G. Zappavigna / GE Oil & Gas
3ODFFDWXUDGLUHFLSLHQWLLQSUHVVLRQHFDVLVWLFKHHVFHOWDGHOOHYDULHWLSRORJLH
DSSOLFDWLYH&$6(678'<SODFFDWXUHQHOODIDEEULFD]LRQHGHL&RNH'UXP
D. Quintiliani, L. Saturno, M. Del Prete / Walter Tosto
Codice: 101510, € 30,00
Soci IIS - Membri IIS Club € 24,00
Dagli anni sessanta l’impegno di IIS e di
,,6&(57QHOODTXDOLÀFD]LRQH FHUWLÀFD]LRQH
HDSSURYD]LRQHGHOSHUVRQDOH31'
G. Costa *
S. Morra **
Sommario / Summary
Questo articolo fornisce informazioni sull’inizio dell’attività di qualificazione/certificazione in Italia e dati e indicazioni sulle esperienze tratte da IIS (Organismo Certificante Accreditato Sincert, poi Accredia, e Notificato CE,
www.iis.it) e poi da IIS CERT (Organismo Certificante Accreditato Accredia e Notificato CE, www.iiscert.it) dall’applicazione delle norme EN 473, ISO 9712 e della direttiva
97/23/CE (PED) per quanto riguarda qualificazione, certificazione e approvazione del personale addetto alle prove
non distruttive. In particolare sono discusse informazioni,
aggiornate al 31 luglio 2012, sull’attività di qualificazione/
certificazione e di approvazione svolta dal gennaio 2001
(anno di inizio dell’applicazione dell’EN 473, seconda
edizione e della direttiva PED) con riferimento alle certificazioni e approvazioni emesse e alla loro suddivisione
per metodo e livello. Inoltre viene segnalato che, all’inizio
del 2011, IIS ha generato due consociate, IIS CERT e IIS
SERVICE, totalmente possedute, alla prima delle quali in
particolare l’IIS ha ceduto le sue attività di certificazione e
approvazione, mantenendo per sé, fra le altre, le attività di
formazione, di insegnamento e di laboratorio; queste ultime, con quelle di ricerca e sviluppo, saranno cedute ad una
terza consociata, IIS PROGRESS (www.iisprogress.it),
che inizierà ufficialmente la sua attività all’inizio del 2013.
This paper offers information on the beginning of qualification/certification activities in Italy and data and indi* Istituto Italiano della Saldatura, Genova
** IIS CERT dell’Istituto Italiano della Saldatura, Genova
cations on the experiences gained by Italian Institute of
Welding (Certifying Body Accredited by Sincert, and then
Accredia, and Notified CE, www.iis.it) and more recently by IIS CERT (Certifying Body Accredited by Accredia
and Notified CE, www.iiscert.it), applying the standards
EN 473, ISO 9712 and the directive 97/23/CE (PED) on
qualification, certification and approval of non destructive
testing personnel.
Particularly information updated to 31 July 2012 are given
and discussed on the activity of qualification/certification
since January 2001 (starting year for the application of
EN 473, second edition, and PED directive) with reference
to the issued certifications and approvals and to their distribution in method and level. Furthermore, it is reported
that at the beginning of 2011 IIS originated two branches,
IIS CERT e IIS SERVICE, both totally owned and passed
to the first one its activities of certification and approval.
Instead IIS maintained the training, education and laboratory activities; all of them, together with research and
development activities, will be transferred to a third IIS
branch, IIS PROGRESS (www.iisprogress.it), which will
officially start these activities at the beginning of 2013.
IIW Thesaurus Keywords:
ASNT; Europe; history; nondestructive testing; personnel
qualification; pressure equipment directive; standards;
UNI EN ISO; USA.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
663
*&RVWDH60RUUD'DJOLDQQLVHVVDQWDO·LPSHJQRGL,,6HGL,,6&(57QHOODTXDOLÀFD]LRQHFHUWLÀFD]LRQHHDSSURYD]LRQHGHOSHUVRQDOH31'
1. Un pizzico di storia
1.1 Dall’ASNT alle UNI EN ISO
La qualificazione/certificazione del personale addetto alle
prove non distruttive ha avuto inizio in Italia negli anni
sessanta, per svilupparsi sostanzialmente verso la metà
del decennio successivo. La prima importante azione di
formazione e qualificazione/certificazione del personale PND
nel nostro Paese è stata presumibilmente realizzata dall'IIS
a La Spezia nel 1969, presso Mariperman (Commissione
Permanente per il Materiale da Guerra della Marina Militare),
per la preparazione di una quindicina di Ispettori destinati
al controllo di fabbricazione di una coppia di sommergibili
di acciaio temprato e rinvenuto ad elevata resistenza HY80,
materiale allora utilizzato per la prima volta nel nostro Paese
in costruzioni così sofisticate (Fig. 1). La qualificazione/
certificazione del personale PND veniva allora condotta
sulle base delle linee guida dell'ASNT, che consistevano
inizialmente in quattro sottili quaderni, uno per ciascuno dei
quattro principali metodi di controllo (LT, MT, RT e UT).
Tale attività si è poi sviluppata sostanzialmente verso la
metà del decennio successivo, dapprima ancora sulla base
delle linee guida ASNT e di altri documenti che prevedevano
requisiti di qualificazione tecnicamente equivalenti (come le
linee guida CICPND) poi, sulla base della prima edizione
della norma europea EN 473 per la formazione, qualificazione
e certificazione del personale che risale al 1993 e che ha
giocato un importante ruolo per l'armonizzazione della
certificazione del personale addetto alle PND.
In tutti quegli anni e fino al nuovo secolo l'IIS ha emesso circa
quindicimila attestati di qualificazione/certificazione: una
stima precisa comporterebbe lunghe ricerche nell'archivio
IIS, allora non ancora informatizzato, forse interessanti dal
punto di vista della storia industriale del nostro Paese ma
lontane dai nostri scopi. Successivamente, l'ISO ha preparato
nel Technical Committee 135 "Non Destructive Testing"
ed emesso nel 2005, una nuova edizione dell'ISO 9712,
naturale evoluzione dell'EN 473, che destava la speranza, poi
delusa, di offrire all'industria, ormai fortemente impegnata
sulla strada della globalizzazione, un unico documento di
base per tutte le attività di qualificazione/certificazione nel
mondo: purtroppo nel ballottaggio finale congiunto ISO/
CEN tale progetto è stato approvato a livello ISO, ma non
a livello CEN.
Finalmente nel 2012 è stata emessa l’ultima edizione
dell’ISO 9712 che, essendo stata approvata nel ballottaggio
finale sia a livello ISO che a livello CEN, ha comportato la
convergenza della norma EN con quella ISO, il ritiro della
prima e, come di consueto, l’assunzione della numerazione
della seconda, individuata quindi, dopo il recepimento del
CEN avvenuto il 12/07/2012 e quello immediatamente
successivo dell’UNI, come UNI EN ISO 9712 (Tab. 1).
Tutti i lavori normativi suddetti sono stati attentamente
seguiti dall'IIS in sede nazionale (Commissione "Prove
Non Distruttive" dell’UNI), europea (CEN TC 138 "Non
Figura 1 - Foto ricordo (1969) di due tra i primi corsi aziendali di saldatura e CND dell’IIS: La Spezia per Mariperman sull’acciaio HY80; Gela
per l’Anic su acciai e leghe da petrolchimica; al centro il responsabile dei corsi, Ing. Giulio Costa
664
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
*&RVWDH60RUUD'DJOLDQQLVHVVDQWDO·LPSHJQRGL,,6HGL,,6&(57QHOODTXDOLÀFD]LRQHFHUWLÀFD]LRQHHDSSURYD]LRQHGHOSHUVRQDOH31'
TABELLA 1 - Dettagli sullo sviluppo della normativa: dai fascicoli dell’ASNT, all’EN 473 e all’ISO 9712 del 2012
&RPHJLjDFFHQQDWRODIRUPD]LRQHTXDOLÀFD]LRQHFHUWLÀFD]LRQHGHOSHUVRQDOH31'QHJOLDQQL¶YHQLYDHIIHWWXDWDVXOOD
EDVHGHOOHOLQHHJXLGDGHOO·$617FKHFRQVLVWHYDQRLQL]LDOPHQWHLQTXDWWURSLFFROLIDVFLFROLXQRSHUFLDVFXQRGHLTXDWWUR
PHWRGLSULQFLSDOL/70757H87HFKHFRPSUHQGHYDQRVRORLOLYHOOLHLQTXDQWRLOOLYHOORYHQLYDFRQIHULWRGDO
GDWRUHGLODYRURVRWWRODSURSULDUHVSRQVDELOLWjDGHFFH]LRQHGHOFDVRGLFRVWUX]LRQLGHOLFDWHFRPHTXHOOHDHURVSD]LDOL
e nucleari.
6XFFHVVLYDPHQWHQHJOLDQQL¶O·$617HPLVHXQQXRYRGRFXPHQWRODEHQQRWD6177&$FKHHGL]LRQHSHUHGL]LRQH
UDFFROVHLQXQXQLFRGRFXPHQWRWXWWLLWUHOLYHOOLHVHPSUHSLPHWRGLÀQRDGDUULYDUHDJOLXQGLFLGHO
/·DWWLYLWj GL IRUPD]LRQHTXDOLÀFD]LRQHFHUWLÀFD]LRQH VL q FRVu VYLOXSSDWD VRVWDQ]LDOPHQWH YHUVR OD PHWj GHJOL DQQL¶
GDSSULPD DQFRUD VXOOD EDVH GHOOH OLQHH JXLGD$617 H GL DOWUL GRFXPHQWL FKH SUHYHGHYDQR UHTXLVLWL GL TXDOLÀFD]LRQH
WHFQLFDPHQWH HTXLYDOHQWL FRPH OH OLQHH JXLGD &,&31' DOOD FXL SUHSDUD]LRQH O·,,6 KD VRVWDQ]LDOPHQWH FRQWULEXLWR
VXFFHVVLYDPHQWHVXOODEDVHGHOODSULPDHGL]LRQHGHOODQRUPDHXURSHD(1FKHULVDOHDOHFKHKDJLRFDWRXQ
LPSRUWDQWHUXRORSHUO·DUPRQL]]D]LRQHGHOODFHUWLÀFD]LRQHGHOSHUVRQDOHDGGHWWRDOOH31'HVVHQGRTXHOORO·DQQRGL
QDVFLWDGHO´JUDQGHPHUFDWRLQWHUQRHXURSHRµ
/·HGL]LRQHGHOO·(1UHFHSLWDGDOO·81,FRPH81,(1QHOQRYHPEUHKDSDU]LDOPHQWHLQQRYDWRPD
VRSUDWWXWWRPHJOLRGHÀQLWRDOFXQLDVSHWWLGHOODQRUPDSUHFHGHQWHGRSRLSULPLDQQLGLHVSHULHQ]DSHUFXLOHSULPH
DSSOLFD]LRQLGHOODQRUPDVRQRVWDWHHIIHWWXDWHLQSDUWLFRODUHGDOO·,,6QRQDSSHQDHVVDqVWDWDHPHVVDGDO&(1RWWREUH
TXLQGLJLjDOO·LQL]LRGHODQQRLQFXLqLQL]LDWDDQFKHO·DSSURYD]LRQHGDSDUWHGHOO·,,6GHOSHUVRQDOHDGGHWWRDOOD
VDOGDWXUDHDOOH31'VHFRQGRODGLUHWWLYD&(3('
1HLSULPLDQQLGHOQXRYRVHFRORO·,62KDSUHSDUDWRQHO7HFKQLFDO&RPPLWWHH´1RQ'HVWUXFWLYH7HVWLQJµXQDQXRYD
HGL]LRQHGHOO·,62HPHVVDQHOQDWXUDOHHYROX]LRQHGHOO·(1FKHGHVWDYDODIRQGDWDVSHUDQ]DGLRIIULUH
DOO·LQGXVWULDRUPDLIRUWHPHQWHLPSHJQDWDVXOODVWUDGDGHOODJOREDOL]]D]LRQHXQXQLFRGRFXPHQWRGLEDVHSHUWXWWHOH
DWWLYLWjGLIRUPD]LRQHTXDOLÀFD]LRQHFHUWLÀFD]LRQHQHOPRQGRFRPHSHUDOWURJLjGDXQGHFHQQLRVWDYDDYYHQHQGRDG
HVHPSLRQHOFDPSRGHOOHÀJXUHSURIHVVLRQDOLGLVDOGDWXUD
3XUWURSSRQHOEDOORWWDJJLRÀQDOHFRQJLXQWR,62&(1WDOHSURJHWWRqVWDWRDSSURYDWRDOLYHOOR,62PDQRQDOLYHOOR&(1
FKHKDTXLQGLSXEEOLFDWRXQDQXRYD(1FKHGLIIHULYDGDOODVXDSUHFHGHQWHHGL]LRQHHGDOO·,62HVVHQ]LDOPHQWH
SHUODSRVVLELOLWjRIIHUWDDOOHD]LHQGHFKHDSSOLFDYDQRXQEHQVWUXWWXUDWRVLVWHPDGLTXDOLWjGLHYLWDUHODSURYDSUDWLFD
SHULOULQQRYRGHOODFHUWLÀFD]LRQHGHLOLYHOOLHDIURQWHGHOO·RJJHWWLYDHYLGHQ]DGRFXPHQWDOHGLXQDVRGGLVIDFHQWHH
FRQWLQXDDWWLYLWjODYRUDWLYDGHOSHUVRQDOHLQWHUHVVDWR
)LQDOPHQWHQHOqVWDWDHPHVVDO·XOWLPDHGL]LRQHGHOO·,62FKHHVVHQGRVWDWDDSSURYDWDQHOEDOORWWDJJLRÀQDOH
VLDDOLYHOOR,62FKHDOLYHOOR&(1KDFRPSRUWDWRODFRQYHUJHQ]DGHOODQRUPD(1FRQTXHOOD,62LOULWLURGHOODSULPD
HFRPHGLFRQVXHWRO·DVVXQ]LRQHGHOODQXPHUD]LRQHGHOODVHFRQGDLQGLYLGXDWDTXLQGLGRSRLOUHFHSLPHQWRGHO&(1H
TXHOORLPPHGLDWDPHQWHVXFFHVVLYRGHOO·81,DYYHQXWRLOFRPH81,(1,62
Destructive Testing") ed internazionale (ISO TC 135 "Non
Destructive Testing"). Conseguentemente i regolamenti
dell’IIS prima e quelli dell’IIS CERT1 poi sono stati
continuamente e tempestivamente aggiornati.
In particolare all’ultima edizione dell’UNI EN ISO 9712
fa riferimento l’attuale documento CER_QAS 021 R
“Regolamento per la certificazione degli operatori di
controlli non distruttivi”, emesso da IIS CERT, nella sua
revisione 3, il 31/07/2012.
1.2 La direttiva PED
L’ampliamento dei confini all’interno del mercato europeo
ha reso necessario l’emanazione della direttiva 97/23 PED,
di applicazione facoltativa a decorrere dal 29 Novembre
1999 e obbligatoria dal 29 Maggio 2002.
Pertanto attualmente qualsiasi attrezzatura a pressione deve
riportare la marcatura CE per poter essere immessa sul
mercato comunitario europeo.
1
All’inizio del 2011 l’Istituto Italiano della Saldatura (www.iis.it) ha conferito
le sue attività di certificazione alla sua consociata IIS CERT (www.iiscert.it)
Rientrano sotto la direttiva 97/23 tutte le attrezzature con
una pressione di progetto superiore a 0,5 bar: in particolare
singole attrezzature come serbatoi, scambiatori, valvole,
accessori di sicurezza e altri accessori a pressione, nonché
insiemi composti da quest’ultime come caldaie e impianti
chiavi in mano; sono pertanto escluse le macchine.
A partire dalla sua entrata in vigore la direttiva PED ha
portato importanti ed interessanti novità anche nei settori
della saldatura e delle prove non distruttive, soprattutto
per quanto riguarda la certificazione del personale addetto
all’esecuzione dei controlli.
In particolare la direttiva ha voluto enfatizzare un concetto
assai rilevante e già in qualche modo espresso dalle
normative relative alla certificazione del personale (UNI
EN 473 e successivamente UNI EN ISO 9712) mediante la
cosiddetta “Autorizzazione ad Operare”.
Il riferimento è, in particolare, alla verifica delle effettive
competenze di un operatore nell’applicare un determinato
metodo di controllo in uno specifico contesto, in questo caso
quello delle attrezzature a pressione.
Tale verifica viene definita appunto “Approvazione” (Tab. 2).
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
665
*&RVWDH60RUUD'DJOLDQQLVHVVDQWDO·LPSHJQRGL,,6HGL,,6&(57QHOODTXDOLÀFD]LRQHFHUWLÀFD]LRQHHDSSURYD]LRQHGHOSHUVRQDOH31'
TABELLA 2 - Dettagli sullo sviluppo e l’applicabilità della direttiva PED
,OFRQFHWWRGLDSSURYD]LRQHFRPHVSHFLÀFDWRQHOWHVWRDSSDUHIDFLOPHQWHFRPSUHQVLELOHTXDQGRLOSHUVRQDOHDGGHWWR
DOOH31'qGLUHWWDPHQWHDOOHGLSHQGHQ]HGHOIDEEULFDQWHFKHUHDOL]]DO·DWWUH]]DWXUDDSUHVVLRQHHRSHUDDOO·LQWHUQRGHO
SURFHVVRGLIDEEULFD]LRQHGHOIDEEULFDQWHVWHVVRLOOHJDPHWUDLOPHWRGRGLFRQWUROORDSSOLFDWRHORVSHFLÀFRFRQWHVWRq
HYLGHQWHHO·DWWLYLWjGLYDOXWD]LRQHHIIHWWXDWDGDOO·(QWLWj7HU]D5LFRQRVFLXWDqUHODWLYDPHQWHSRFRDUWLFRODWD
1HOFDVRGLSHUVRQDOHFKHRSHUDLQYHFHSHUFRQWRGL6RFLHWjIRUQLWULFLGHOVHUYL]LR31'SUHVVRLIDEEULFDQWLGLDWWUH]]DWXUH
DSUHVVLRQHO·DWWLYLWjGLYDOXWD]LRQHHIIHWWXDWDGDOO·(QWLWj7erza 5LFRQRVFLXWDFRPSRUWDTXDOFKHGLIÀFROWjLQSLGRYHQGR
HVVHUHGDWDHYLGHQ]DRJJHWWLYDGHOOHHIIHWWLYHFRPSHWHQ]HGHJOLRSHUDWRULSHULOFRQWUROORGHOOHGLYHUVHDWWUH]]DWXUHD
SUHVVLRQHFKHHYLGHQWHPHQWHVLGLIIHUHQ]LDQRSHUWLSRGLPDWHULDOHWLSRGLSURFHVVLGLJLXQ]LRQHHVDOGDWXUDQRQFKpSHU
DSSOLFDELOLWjRPHQRGLSDUWLFRODULWHFQLFKHGLFRQWUROORQHOO·DPELWRGLXQRVSHFLÀFRPHWRGR
/·,,6SULPDO·,,6&(57DWWXDOPHQWHqXQD(QWLWj7HU]D5LFRQRVFLXWDSHUO·DSSURYD]LRQHGHOSHUVRQDOH31'LQDFFRUGRDOOD
GLUHWWLYD3('HSHUHQWUDPEHOHVLWXD]LRQLGLFXLVRSUDVLqGRWDWRGLRSSRUWXQLFULWHULHUHJROHWHFQLFKHROWUHDTXHOOL
RYYLDPHQWHSUHYLVWLGDOOHQRUPHGLULIHULPHQWRSHUJDUDQWLUHXQ·DSSURYD]LRQHFRQHOHYDWRYDORUHDJJLXQWRDVXSSRUWR
GHLIDEEULFDQWLHGHOORURLPSHJQRDGDVVLFXUDUHDGHJXDWHSUHVWD]LRQLSHUOHSURSULHDWWUH]]DWXUHDSUHVVLRQH
$IÀQFKpTXHVWHXOWLPHHLORURLQVLHPLSRVVDQRHVVHUHPDUFDWL&(qQHFHVVDULDXQDYHULÀFDGLFRQIRUPLWjDLUHTXLVLWL
GHOODGLUHWWLYD3('YHULÀFDFKHGHYHHVVHUHVYROWDGDXQ2UJDQLVPR1RWLÀFDWRFRQPRGDOLWjSLRPHQRDSSURIRQGLWH
DVHFRQGDGHOULVFKLRSUHVVLRQH
TABELLA 3 - Metodi PND, certificati EN/ISO e approvazioni CE in vigore al 31
luglio 2012
Simbolo
CEN/ISO
CertiÀcati
EN e ISO
Approvazioni
CE
&RUUHQWLLQGRWWH
(7
7HUPRJUDÀDDOO
LQIUDURVVR
77
5LYHOD]LRQHGLIXJKH
/7
3DUWLFHOOHPDJQHWLFKH
07
/LTXLGLSHQHWUDQWL
37
5DGLRJUDÀD
57
8OWUDVXRQL
87
9LVLYR
97
(VWHQVLPHWULD
67
Metodo
2. Attività dell’IIS e di IIS CERT
All'inizio degli anni 2000, l'Istituto Italiano della Saldatura
ha completato l'informatizzazione per la gestione della
sua Divisione Certificazione ed è quindi agevole, oltre che
significativo, fornire e discutere i dati opportunamente
aggregati e paragonabili sull’esperienza maturata dal
Gruppo IIS nell'applicazione delle varie edizioni delle
norme EN 473 e ISO 9712 nonché della direttiva PED dal
gennaio 2001 fino al luglio 2012 compresi, tenendo quindi
conto che all’inizio del 2011 l’IIS ha conferito le sue attività
di qualificazione/certificazione ed approvazione alla sua
consociata IIS CERT2. Quest’ultima ha come oggetto
attività di qualificazione, approvazione, certificazione,
con riferimento alle tecnologie di giunzione ed a quelle
connesse, affini e contigue, nonché alle relative applicazioni,
in contesti quali, a titolo esemplificativo e non esaustivo,
sistemi, processi e procedure, prodotti, personale. Inoltre
666
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
Figura 2 - Certificazioni IIS secondo UNI EN e ISO in
vigore al 31/07/2012 suddivise per i livelli 1, 2 e 3
IIS CERT ha per oggetto attività di ispezione e valutazione
di conformità a fronte di Direttive europee e/o Decreti
nazionali relativi al comparto industriale, con riferimento,
ancora a titolo esemplificativo e non esaustivo, ai settori
energia, trasporti, impiantistica, strutture industriali e civili
ed elettromeccanico in genere.
I metodi PND per i quali l'IIS ha operato fino al 2010 e
per i quali IIS CERT attualmente opera come Organismo
Certificante Accreditato da Accredia e Notificato CE3 sono
2
3
All’inizio del 2011 l’Istituto Italiano della Saldatura (www.iis.it) ha anche
conferito le sue attività di consulenza, sorveglianza e controllo alla sua
consociata IIS SERVICE (www.iisservice.it), mentre all’inizio del 2013 l’IIS
conferirà le sue attività di formazione e laboratorio alla sua terza consociata IIS PROGRESS (www.iisprogress.it) che sarà appunto attiva dal
01/01/2013.
L’Istituto Italiano della Saldatura fino al 2010 e l’IIS CERT (www.iiscert.it)
dall’inizio del 2011 sono Ente Notificato CE e Organismo Accreditato da
Accredia (precedentemente Sincert) per l’approvazione / qualificazione
/ certificazione di saldatori, operatori di saldatura, addetti alle prove non
distruttive e procedure di saldatura.
*&RVWDH60RUUD'DJOLDQQLVHVVDQWDO·LPSHJQRGL,,6HGL,,6&(57QHOODTXDOLÀFD]LRQHFHUWLÀFD]LRQHHDSSURYD]LRQHGHOSHUVRQDOH31'
TABELLA 4 - Certificati EN e ISO in vigore per livello e per metodo
Metodo
ET
TT
LT
MT
PT
RT
UT
VT
ST
Totali
Livello 1
97
2
28
26
32
44
93
21
10
353
Livello 2
168
63
34
1035
1278
636
987
1070
7
5233
Livello 3
6
--
1
75
72
44
73
44
2
317
Totali
271
65
63
1131
1372
724
1138
1120
19
5903
indicati nella Tabella 3, con il relativo simbolo EN/ISO e
con il numero di qualificazioni/certificazioni EN/ISO ai
livelli 1, 2 e 3 e di approvazioni CEE rilasciate dal gennaio
2001 al luglio 2012 compresi. La Figura 2 mostra anzitutto
il numero di certificati EN/ISO per livello e conferma
l'interesse delle aziende particolarmente per il personale di
livello 2, in quanto, tra l'altro, competente ed autorizzato a
selezionare le tecniche di prova, ad eseguire le prove stesse
e a interpretarne e valutarne i risultati in conformità alle
norme, ai codici e/o alle specifiche applicabili.
3. CertiÀcazioni ai livelli 1 e 2
Il numero di certificati secondo EN/ISO in vigore per i
livelli 1 e 2 al 31/07/2012, suddiviso per i relativi metodi, è
riportato nella Tabella 4.
La Figura 3 mostra la distribuzione dei certificati secondo
EN/ISO in vigore per i livelli 1 e 2 al 31/07/2012 per metodo
e mette in evidenza la preponderanza di quelli per controlli
superficiali, in quanto di più immediata applicazione ma
comunque adeguati a rilevare la mancanza di anomalie in
molti casi pratici; tra questi metodi il controllo con liquidi
penetranti è quello un po’ più utilizzato, presumibilmente
per la semplicità delle apparecchiature, mentre l'interesse
per quello visivo, di più recente introduzione, è cresciuto
rapidamente superando, sia pur di poco, quello per il
metodo con particelle magnetiche. Tra i metodi volumetrici
le certificazioni più richieste sono quelle relative al controllo
Figura 3 - Certificazioni IIS secondo UNI EN e ISO in vigore al
31/07/2012 per i livelli 1 e 2 suddivise per metodo
ultrasonoro; in effetti l'applicazione del controllo radiografico
è in lento ma costante declino, per il costo delle installazioni
e delle apparecchiature, per le minori prestazioni, soprattutto
nel caso degli spessori più elevati e per la rilevanza
ambientale ed economica delle misure di sicurezza. Gli
altri metodi, molto specialistici, sono presenti in misura
marginale. La maggior parte degli esami di qualificazione/
certificazione ai livelli 1 e 2 è stata effettuata presso il Centro
d'esame del Gruppo IIS, organizzato anche come centro
d'esame itinerante, e presso i Centri Attrezzati del Gruppo,
ma un certo numero di esami è stato svolto anche presso
Figura 4 - Nella moderna sede genovese dell’IIS un’aula e la sala Rx (a destra, in primo piano la porta di cemento al bario dello spessore di 840
mm e del peso di 19 t e sullo sfondo un’apparecchiatura radiogena da 160 kV con macchia focale da 1x1 mm) utilizzate per la formazione, la
qualificazione e la certificazione in saldatura e CND
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
667
*&RVWDH60RUUD'DJOLDQQLVHVVDQWDO·LPSHJQRGL,,6HGL,,6&(57QHOODTXDOLÀFD]LRQHFHUWLÀFD]LRQHHDSSURYD]LRQHGHOSHUVRQDOH31'
TABELLA 5 - Centri d’esame approvati da IIS/IIS CERT
Centro
Responsabile
Telefono
Web e E-mail
Metodi
Istituto Italiano della
Saldatura
Sede Centrale
/XQJRELVDJQR,VWULD
*HQRYD*(
FHQWURLWLQHUDQWH
'RWW,QJ
6LPRQH586&$
ZZZLLVLW
ZZZLLVFHUWLW
ZZZIRUPD]LRQHVDOGDWXUDLW
LLV#LLVLW
VLPRQHUXVFD#LLVLW
(7/70737578797
Sede di Legnano
9LD3LVDFDQH
/HJQDQR0,
FHQWURDWWUH]]DWR
'RWW,QJ
6LPRQH586&$
LLVORP#LLVLW
UHQDWRGHOODUDJLRQH#LLVLW
VLPRQHUXVFD#LLVLW
(7/70737578797
Sede di Modena
9LDOH9LUJLOLR&
0RGHQD02
FHQWURDWWUH]]DWR
'RWW,QJ
6LPRQH586&$
LLVHPL#LLVLW
JLDQQLDUOHR#LLVLW
VLPRQHUXVFD#LLVLW
(7/70737578797
Sede di Mogliano Veneto
9LD0DUFRQL
0RJOLDQR9HQHWR79
FHQWURDWWUH]]DWR
'RWW,QJ
6LPRQH586&$
LLVYHQ#LLVLW
HJLGLRELUHOOR#LLVLW
VLPRQHUXVFD#LLVLW
(7/70737578797
Sede di Priolo
9LDOH$QQXQ]LDWD(
3ULROR*DUJDOOR65
FHQWURDWWUH]]DWR
'RWW,QJ
6LPRQH586&$
LLVVLF#LLVLW
EUXQRVFXOOL#LLVLW
VLPRQHUXVFD#LLVLW
(7/70737578797
Sede di Taranto
9LDOH9LUJLOLR
7DUDQWR7$
FHQWURDWWUH]]DWR
'RWW,QJ
6LPRQH586&$
LLVSXJ#LLVLW
JLDQYLWRPDULJJLR#LLVLW
VLPRQHUXVFD#LLVLW
(7/70737578797
AQM
9LD(GLVRQ
3URYDJOLRG
,VHR%6
3,
*LXVHSSH
&2592
www.aqm.it
(707375787
BYTEST
9LD3LVD
9ROSLDQR72
'RWWVVD
0DULQD3202
ZZZE\WHVWFRP
(7/70737578797
CND Studio
9LD6WLOLFRQH
0LODQR0,
3,
*LQR
)$%%5,
ZZZFQGVWXGLRLW
(7073757778797
Lucchini RS
9LD*3DJOLD
/RYHUH%*
3,
*ODXFR
3$7(//,
JSDWHOOL#OXFFKLQLUVLW
(7073757678797
1RWD(*)'DOOHDWWLYLWjGL&HUWLÀFD]LRQHH$SSURYD]LRQHGHO*UXSSR,,6VRQRVYROWHGD,,6&(57
1RWD(**): In allestimento.
le aziende richiedenti (Fig. 4). L'elenco dei centri d'esame
approvati dal Gruppo IIS al 30 luglio 2012 è riportato nella
Tabella 5. Una parte interessante degli esami effettuati,
corrispondente ad alcuni punti percentuali sul totale, è stata
relativa a certificazioni limitate o speciali emesse sulla
base delle flessibilità consentite dalle ultime edizioni delle
norme EN 473 e ISO 9712, che IIS e poi IIS CERT, come
668
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
Organismo Certificante, hanno opportunamente applicato
alle necessità delle aziende richiedenti. In particolare le
aziende hanno mostrato notevole interesse alle certificazioni
suddette soprattutto per i seguenti metodi e casi:
r prove a bolle;
r radiografia digitale;
r radiografia per lettura e interpretazione lastre;
*&RVWDH60RUUD'DJOLDQQLVHVVDQWDO·LPSHJQRGL,,6HGL,,6&(57QHOODTXDOLÀFD]LRQHFHUWLÀFD]LRQHHDSSURYD]LRQHGHOSHUVRQDOH31'
TABELLA 6 - Struttura delle sessioni d’esame IIS CERT secondo ISO 9712
0DWWLQR
Lunedì
Martedì
3URYDGLPHWRGRDTXL] 3URYDGLPHWRGRDTXL] 3URYDGLPHWRGRDTXL] 3URYDGLPHWRGRDTXL]
3RPHULJJLR (VDPHGLEDVHDTXL] 6WHVXUDSURFHGXUD
r
r
r
r
Mercoledì
Giovedì
6WHVXUDSURFHGXUD
6WHVXUDSURFHGXUD
Venerdì
6WHVXUDSURFHGXUD
ultrasuoni per controllo spessori;
ultrasuoni per controllo automatizzato;
ultrasuoni per controllo TOFD e Phased Array;
onde guidate.
4. CertiÀcazioni al livello 3
Il numero di certificati secondo EN/ISO in vigore al
31/07/2012 per il livello 3, suddiviso per i relativi metodi,
è riportato nella Tabella 4, mentre la Figura 5 ne sintetizza
la distribuzione, che ricorda quella dei livelli inferiori.
Le sessioni d'esame di livello 3 sono tenute almeno
semestralmente4 con calendari personalizzati per i singoli
candidati in modo da ridurre il loro impegno temporale fino
ad una sola giornata per ogni metodo (Tab. 6); esse prevedono
anche eventuali prove di recupero, nei tempi previsti dalla
norma ISO 9712, per le parti d'esame non superate.
Figura 5 - Certificazioni EN/ISO in vigore al 31/07/2012 per il livello
3 suddivise per metodo
5. Approvazioni
Il rilascio di approvazioni secondo la direttiva 97/23/CE
(PED) da parte di IIS CERT, in qualità di Entità Terza
Riconosciuta, si articola secondo tre possibili percorsi a
seconda se il personale sia già in possesso di certificazione
secondo EN/ISO (emesso da un organismo accreditato
secondo ISO 17024), di qualificazione secondo ASNT o sia
altrimenti qualificato.
In ogni caso il datore di lavoro deve fornire all’Organismo
Notificato (attualmente IIS CERT) il curriculum vitae del
candidato, una dichiarazione attestante la relativa esperienza
lavorativa orientata alla tipologia di prodotto controllato, le
procedure aziendali di controllo, l'elenco delle attrezzature
CND dell'azienda, delle norme di prodotto utilizzate
dall'azienda a fronte delle quali si richiede l'approvazione
del personale CND e l'elenco dei materiali impiegati (tipo di
semilavorato e norma di riferimento).
Il numero di approvazioni rilasciate è indicato nella Tabella 3,
mentre la Figura 6 ne sintetizza la distribuzione per metodo,
che risulta abbastanza equilibrata, ma ancora con una certa
prevalenza dei controlli superficiali.
6. Conclusioni
Dagli anni ‘60 l’IIS ha dedicato particolare attenzione
alla qualificazione e successivamente alla certificazione
e approvazione del personale addetto alle PND.
Conseguentemente IIS e IIS CERT del Gruppo IIS hanno
Figura 6 - Approvazioni secondo direttiva PED suddivise per metodo
seguito attentamente lo sviluppo, in sede nazionale ed
internazionale, di linee guida, come quelle ASNT, di norme,
come quelle UNI, EN e ISO e di direttive come quella PED.
Tale sviluppo ha compreso, soprattutto inizialmente, un
notevole impegno degli esperti di normazione nazionali (in
particolare dell’industria e del Gruppo IIS) ed internazionali
per la precisazione e l’armonizzazione dei requisiti richiesti;
ciò ha consentito il riconoscimento internazionale, da
parte di produttori e consumatori, degli attestati rilasciati
4
Le sessioni d’esame per il livello 3 sono tradizionalmente tenute nei
mesi di marzo e ottobre. Per le modalità di partecipazione IIS ed IIS
CERT emettono appositi bandi che sono pubblicati sulla Rivista Italiana della Saldatura e sul sito istituzionale www.iis.it o su quello specifico
www.iiscert.it.
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
669
*&RVWDH60RUUD'DJOLDQQLVHVVDQWDO·LPSHJQRGL,,6HGL,,6&(57QHOODTXDOLÀFD]LRQHFHUWLÀFD]LRQHHDSSURYD]LRQHGHOSHUVRQDOH31'
dagli Organismi Certificanti accreditati e notificati. In un
secondo tempo, lo sforzo degli esperti di normazione è stato
indirizzato alla preparazione di procedure più flessibili, volte
alla semplificazione dei processi e quindi alla riduzione
dei costi aziendali, ma comunque ancora sufficientemente
rigorose, in modo da non intaccare la confidenza degli
utilizzatori nella qualificazione/certificazione/approvazione
degli addetti alle PND e consentire la più ampia possibilità
di riconoscimento reciproco delle attestazioni, sempre
più essenziale per lo sviluppo internazionale dei traffici.
Finalmente nel luglio 2012 è stato raggiunto il traguardo
finale, consistente nell’emissione della norma UNI EN ISO
9712, che ha validità generale in quanto approvata da tutti
i Paesi interessati, europei ed extraeuropei. A quest’ultima
norma, in particolare, fa riferimento l’attuale documento
CER_QAS 021 R “Regolamento per la certificazione degli
operatori di controlli non distruttivi”, emesso da IIS CERT,
nella sua revisione 3, il 31/07/2012.
Fondamentali per raggiungere tale traguardo sono state
l’esperienza, la capacità e la disponibilità dei più attenti
Organismi Certificanti (in particolare dell’IIS che dal 2011
ha conferito le sue attività di certificazione e approvazione
a IIS CERT) di porsi, nell'ambito delle prescrizioni e
sotto la supervisione dell'Organismo di Accreditamento
e dell'Autorità di Notifica, al servizio delle aziende
interpretandone bisogni e necessità e fornendo loro soluzioni
adeguate e personalizzate.
Al 31/07/2012 risultavano globalmente in corso di validità
circa 6150 tra certificazioni ed approvazioni emesse dal
Gruppo IIS, tutte coperte da accreditamento o riconoscimento
Accredia o CE.
A monte dell’attività di formazione, qualificazione,
certificazione e approvazione nel campo delle PND del
Gruppo IIS stanno quindi un’approfondita conoscenza degli
strumenti normativi e delle direttive, che esso ben possiede
avendo sempre partecipato alla formazione delle delegazioni
italiane al CEN TC 138, all’ISO TC 135 e alla Direzione
Industria della Commissione Europea, contribuendo
fattivamente a tutte le discussioni nazionali e internazionali
rilevanti per l’interesse dei produttori e degli utilizzatori
nazionali e per il progresso delle PND.
Ringraziamenti
Gli autori ringraziano la Sig. ra Luisa Marongiu per la
raccolta e l’elaborazione dei dati.
Giulio COSTA, laureato in Ingegneria Industriale Elettrotecnica presso l’Università di Genova nel 1964, entra
all’Istituto Italiano della Saldatura nel 1965. Nel 1977 è certificato livello 3 LT, MT, RT, UT (e successivamente VT) e
diventa Dirigente responsabile delle attività di Insegnamento, Certificazione, Ricerca e Normazione.
Come responsabile dei Comitati Tecnici dell’IIS, svolge intensa attività in numerose Commissioni di studio e
normazione nazionali, europee ed internazionali ricoprendo inoltre il ruolo di Presidente della Commissione
“Concezione e fabbricazione delle strutture saldate” dell’Istituto Internazionale della Saldatura (IIW) dal 1986 al
1997 e di Presidente della Commissione “Saldature” dell’UNI dal 1991 al 2009. Nominato Vice-Segretario Generale
nel 1985, è Segretario Generale dell’IIS dal 1990 al 1996. Nello stesso periodo viene inoltre certificato EWE/IWE
e EWI/IWI e viene nominato Tesoriere dell’IIW e Membro del Board of Directors dell’IIW e dell’European Welding
Federation (EWF); dal 1990 al 2002 è Presidente del Comitato “Publication” dell’IIW. Dal 1997 è Membro del
Comitato Direttivo e Consulente Generale Onorario dell’IIS. Dal 1999 al 2001 è Presidente dell’EWF e nuovamente
Membro del Board of Directors dell’IIW. Dal 2000 al 2009 è Capo del Gruppo Settoriale “Protezione individuale
e beni di largo consumo” della Commissione Centrale Tecnica dell’UNI. Dal 2011 è Vice Presidente dell’IIS ed è
membro del Consiglio di Amministrazione di IIS CERT e, dal 2013, di IIS PROGRESS.
Stefano MORRA, laureato in Ingegneria Civile presso la Facoltà di Ingegneria dell’Università di Genova nel 1995.
Funzionario dell’Istituto Italiano della Saldatura dal 1996, si è occupato principalmente di assistenza tecnica alla
progettazione e fabbricazione di strutture metalliche di carpenteria nel settore civile e ferroviario.
Nominato dirigente IIS nel 2010, ha ricoperto la funzione di Vice Responsabile della Divisione Certificazione e di
Responsabile dell’Area Certificazione Figure Professionali in Saldatura e Prove non Distruttive. Nel 2011 è nominato
Direttore Tecnico dell’IIS CERT. Nel campo della saldatura possiede la certificazione di EWE/IWE, mentre nel
campo dei controlli non distruttivi possiede le certificazioni ISO 9712 di Livello 2 e 3 nei metodi MT e RT ed è inoltre
certificato dall’ASNT come Level 3 nel metodo “Magnetic Particle Test”.
In sede internazionale è membro del Board of Directors dell’International Authorization Board (IAB) dell’Istituto
Internazionale della Saldatura e Presidente del Gruppo B “Rules and Authorization” per la Qualificazione e
Certificazione delle Figure Professionali di Coordinamento e Ispezione in Saldatura e la Certificazione delle Aziende,
nonché delegato UNI all’ISO TC 44 “Welding” e al CEN TC 121 “Welding”.
670
5LYLVWD,WDOLDQDGHOOD6DOGDWXUDQ6HWWHPEUH2WWREUH
M.Yamazaki
et al.
- Creep
International Institute
elding
g rupture properties and fracture type of 9Cr-1Mo-V-Nb/18Cr-8Ni steel dissimilar joints
of W
Welding
Creep rupture properties
and fracture type of
9Cr-1Mo-V-Nb/18Cr-8Ni
steel dissimilar joints (°)
M. Yamazaki
T. Watanabe
H. Hongo
M. Tabuchi
*
*
*
*
Summary / Sommario
1.Introduction
18Cr-8Ni and 9Cr-1Mo-V-Nb steels
are used mostly in thermal/nuclear
power plants owing to their high
strength at high temperatures. In structural components after long-term service at high temperature, however,
fracture occurs mainly not in the base
metal part, but in the weldments.
9Cr-1Mo-V-Nb steel is used mostly in
thermal power plants. Because about
ten years have passed from its practical application, there have been growing concerns about age-degradation in
the mechanical properties at elevated
temperatures of structural components manufactured from this steel
[1]. Therefore, many researches have
been conducted to predict the creep
life and residual life of base metal of
9Cr-1Mo-V-Nb steel [2-14]. Recently,
nucleation and propagation of creep
cracks (the fracture is now recognized
as Type IV fracture) in the fine-grained
HAZ (Heat-Affected Zone) regions of
9Cr-1Mo-V-Nb weld joints after longterm service have become a worldwide
problem to solve [15-39].
(°) Doc. IIW-1893-09, Recommended for Publication by Commission IX “Behaviour of Metals
Subjected to Welding”.
* National Institute for Materials Science, Tokyo
(Japan).
By conducting long-term creep rupture tests for dissimilar weld joints
(9Cr-1Mo-V-Nb/18Cr-8Ni) made with Gas Tungsten Arc Welding (GTAW) and
Friction Joining (FJ), creep rupture properties and microstructures were examined, and the relationships between changes in microstructure and nucleation and propagation of creep cracks that occur during creep deformation in
weld joint specimens were studied. Creep rupture tests of GTAW joints were
conducted at three temperatures: 550, 600 and 650 °C, under applied stresses
of 160-240 MPa, 80-160 MPa and 40-80 MPa, respectively. Creep rupture
tests of FJ joints were conducted at 600 °C and 650 °C under stresses ranging
from 40 to 160 MPa and 30 to 80 MPa, respectively. The creep-rupture strength
of dissimilar weld joint specimens was lower than that of the 9Cr-1Mo-V-Nb
base metal specimen at all temperature levels. In addition, the differences in
creep strength between the dissimilar weld joint specimen and the base metal
specimen tended to be greater at higher temperature levels.
The fracture type of dissimilar weld joint was transformed from a Type V
fracture and a Type VII fracture mode to a Type IV fracture mode following
long-term creep rupture tests. The fracture type of the dissimilar weld joints
was predicted as a Type IV fracture mode at 550 °C and 600 °C and with
rupture occurring after 100 000 hours.
Per effettuare prove di creep di lunga durata su giunti dissimili (9Cr-1Mo-VNb/18Cr-8Ni) realizzati con processo di saldatura TIG e ad attrito, sono state
esaminate le proprietà di resistenza a rottura e le microstrutture e sono state
studiate le relazioni esistenti tra le variazioni microstrutturali, la nucleazione e
la propagazione di cricche dovute a deformazione dei provini in regime di creep. Le prove di creep su giunti saldati con processo TIG sono state eseguite a
tre temperature: 550, 600 e 650 °C, con applicazione di carichi rispettivamente
di 160-240 MPa, 80-160 MPa e 40-80 MPa. Le prove di creep su giunti saldati
a frizione sono state condotte a 600 °C e 650 °C, con applicazione di carichi
da 40 a 160 MPa e da 30 a 80 MPa, rispettivamente. La resistenza a rottura dei
provini ricavati da giunti dissimili è risultata inferiore a quella del provino di
materiale base 9Cr-1Mo-V-Nb, a tutti i livelli di temperatura. Inoltre, le differenze di resistenza allo scorrimento viscoso tra il provino di materiale dissimile e quello di materiale base tende ad essere maggiore a livelli di temperatura
elevati. In seguito a prove di creep di lunga durata, il tipo di frattura del giunto
saldato si è trasformato da una modalità di tipo V e VII ad una di tipo IV. Il tipo
di frattura dei giunti dissimili è stato previsto come Tipo IV alle temperature di
550 °C e 600 °C e con rottura dopo 100 000 ore.
IIW Thesaurus Keywords:
Austenitic stainless steels; creep; creep resisting materials; creep strength;
creep tests; dissimilar materials; dynamically recrystallised zone; elevated
temperature strength fractures; friction welding; GTA welding; high alloy Cr
Mo steels; high alloy steels; high temperature; mechanical properties; mechanical tests; microstructure; recrystallization; stainless steels; stress rupture
strength; weldability.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
671
M.Yamazaki et al. - Creep rupture properties and fracture type of 9Cr-1Mo-V-Nb/18Cr-8Ni steel dissimilar joints
TABLE 1 - Chemical compositions of 9Cr-1Mo-V-Nb, Inconel 82 and 18Cr-8Ni steels [mass %.]
Materials
C
Si
Mn
P
S
Ni
Cr
Mo
Cu
Fe
V
9Cr-1Mo-V-Nb
0.10
0.24
0.44
0.005 0.001
Inco. 82
(WEL-82)
0.03
0.21
2.99
18Cr-8Ni
0.06
0.52
0.93
0.04
8.74
0.94
0.012
-
0.21
0.003 0.001 73.74 18.54
-
0.01
1.39
-
-
0.029 0.008
-
-
-
-
-
8.89
18.32
Al
Nb Nb+Ta
N
Ti
-
0.058
-
-
2.68
-
0.28
-
-
-
-
0.014 0.076
TABLE 2 - Welding conditions for gas tungsten arc welding
Welding
Butter weld
Butt weld
Groove
-
U
WEL-82
WEL-82
Welding current [A]
230
200-250
Arc voltage [V]
10.5
10.5
10
10
1.45
1.26-1.58
273-230
100-110
730 x 8.4 h
-
Wire
Welding speed [cm/min]
Heat input [kJ/mm]
Interpass temperature [°C]
Post-weld heat treatment [°C]
The results of these investigations
have shown that Type IV fracture occurred in the weld joint specimens in
lower-stress creep regions. Research
has also been conducted on creep rupture properties of dissimilar weld joint
specimen cut out of weldments.
Creep rupture properties and microstructural changes were examined in
this study by conducting long-term
creep rupture tests on dissimilar weld
joint specimens of 18Cr-8Ni and 9Cr1Mo-V-Nb steel. The relationship between changes in microstructure and
nucleation and propagation of creep
cracks occurring during creep deformation of dissimilar weld joint specimens was studied.
2. Preparation of weld joints
and sampling of weld joint
specimens
2.1 Gas tungsten arc welding joint
18Cr-8Ni and 9Cr-1Mo-V-Nb steel
plates, each with a thickness of 25
mm, were used in the manufacture of
weldments.
672
The welding material used for buttering and butt welding was WEL-82.
The first step in
the welding process was the weld
buttering of the
9Cr-1Mo-V-Nb
steel plate using
wire, WEL-82.
Next, a post-weld
heat
treatment
(PWHT) was conducted at a temperature of 730 °C for
8.4 h. Lastly, butt welding with the
18Cr-8Ni plate was conducted using
the same type of wire as in the buttering procedure. This welding process
together with the welding build-up sequence is shown in Figure 1.
The process used for both weld buttering and butt welding was gas tungsten
arc welding (GTAW). The chemical
compositions of the base metal and the
weld metal and the welding conditions
are shown in Tables 1 and 2, respectively. Figure 2 shows the macrostructure of the cross-sectional area in the
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
Figure 1 - Welding procedure of GTAW dissimilar weld joint
Figure 2 - Cross-sectional view of the GTAW
dissimilar weld joint
weld joint of the plate. X-ray inspection of the weld joint revealed no defects. The white spots, seen in Figure
2, along the centre of the plate are indentations that resulted from hardness
testing. Flat plate-type creep specimens with a width of 5 mm, thickness
of 17.5 mm, and gauge length of 100
mm were sampled in the direction perpendicular to the weld line of the weld
joint, with the sectioned butt weld located in the centre of the gauge portion of the specimen. Figure 3 shows
sampling location of the flat plate-type
creep specimen.
M.Yamazaki et al. - Creep rupture properties and fracture type of 9Cr-1Mo-V-Nb/18Cr-8Ni steel dissimilar joints
TABLE 3 - Chemical compositions of used steels [Mass %]
Materials
C
Si
Mn
P
S
C
Ni
Mo
V
Nb
18Cr-8Ni
0.06
0.6
0.97
0.025
0.006
18.00
8.97
0.012
-
-
309S
0.07
0.32
1.63
0.029
0.001
13.24
22.57
-
-
-
310S
0.03
0.23
1.15
0.027
0.001
19.31
24.20
-
-
-
9Cr-1Mo-V-Nb
0.08
0.34
0.49
0.005
0.004
8.34
0.09
0.89
0.23
0.07
18Cr-8Ni: JIS SUS304-HP. 1 100 °C – 25 min – WQ. 309S: JIS SUS309S bar, 1 080 °C – WQ. 310S: JIS SUS310S bar, 1 120 °C – WQ.
9Cr-1Mo-V-Nb: ASME SA-387 Grade 91, 1 050 °C -10 min-AC, 770 °C -60 min–AC, 740 °C – 8.4 h-FC.
Figure 3 - Sampling of test specimen from the
GTAW dissimilar weld joint
Figure 5 - Cross-sectional view of the dissimilar friction joint
2.2 Friction joining
Figure 4 - Joining procedure of dissimilar friction joint
The materials used were 9Cr-1Mo-VNb and 18Cr-8Ni steels with a thickness of 25 mm. The creep properties
of the base metal of the present steel
were published as NRIM Creep Data
Sheet No. 43 [40]. The steel plates
were joined using Friction Joining
(FJ). The chemical compositions of
the base metal and the insert metal are
shown in Table 3. Figure 4 shows the
friction joining procedures and conditions. Figure 5 shows the cross-sectional view of the friction joints. X-ray
inspection of the weld joint revealed
no welding defects. Figure 6 shows the
overview of the round bar-type creep
specimens with a diameter of 10 mm
and a gauge length of 100 mm.
3. Experimental method
Figure 6 - Creep rupture specimen of the dissimilar friction joint
Tensile tests were conducted at room
temperature, 550, 600, and 650 °C.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
673
M.Yamazaki et al. - Creep rupture properties and fracture type of 9Cr-1Mo-V-Nb/18Cr-8Ni steel dissimilar joints
Figure 8 - Hardness distribution in the GTAW
dissimilar weld joint
Figure 7 - Average linear expansion coefficients of used alloys
The rate of strain for the elevated
temperature tensile test was 5%/min.
Creep rupture tests of GTAW joint
were conducted at three temperatures: 550, 600, and 650 °C, under
applied stresses of 160–240 MPa,
80–160 MPa, and 40–80 MPa, respectively. Creep rupture tests of FJ
joints were conducted at two temperatures: 600 °C and 650 °C with
applied stresses in the ranges 40160 MPa and 30-80 MPa, respectively. Hardness measurements were carried out using a Micro-Vickers hardness testing machine with a measuring
pitch of 0.3 mm, load of 4.9 N, and a
holding time of 30 s, beginning at the
HAZ opposite the fracture surface of
the specimen, using the bond line as a
start. The average linear expansion coefficients of the five materials used in
this study were measured using thermal analysis equipment.
Microstructural observations of aswelded material and ruptured specimens were made using an optical microscope (OM) and a scanning electron microscope (SEM).
4. Results and discussion
4.1 Linear expansion coefficient
and hardness distribution of dissimilar weld joints
In general, there was a significant difference between the linear expansion
coefficients for the ferritic and austenitic steels. As a result, surface crack-
Figure 9 - Hardness distribution in the dissimilar friction joint
674
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
ing occurred when the dissimilar weld
joints, connecting these dissimilar
types of steel, came into direct contact
with heat. The average coefficient of
linear expansion for the five types of
steel at around the service temperature
is shown in Figure 7. The coefficients
of linear expansion, for each type of
steel, increased with increasing temperature. Furthermore, the coefficients
increased in the order of 9Cr-1Mo-VNb, Inconel 82, 310S, 309S and 304
steels. It was estimated that the Inconel
82 steel that was used as filler material for GTAW in this experiment, had
a mean coefficient of linear expansion
that was intermediate to those of the
9Cr-1Mo-V-Nb and 18Cr-8Ni steel.
The hardness distribution of the GTAW
Figure 10 - Short-time tensile strength of
GTAW dissimilar weld joint
M.Yamazaki et al. - Creep rupture properties and fracture type of 9Cr-1Mo-V-Nb/18Cr-8Ni steel dissimilar joints
TABLE 4 - Tensile strength of friction dissimilar joints and base metals
Materials
Tensile strength [MPa]
at room temperature
at 600 °C
at 650 °C
304
630
370
313
G91
676
320
266
309S joint
648
LF: G91
315
LF: G91
254
LF: G91
310S joint
569
LF: 310
323
LF: 310
251
LF: G91
LF/Location of fracture.
dissimilar weld joints, prior to testing,
is shown in Figure 8. The hardness of
the section of 9Cr-1Mo-V-Nb steel
ranged from 220-230HV.
In contrast, the hardness of the Inconel
82 steel section showed a convex shape
distribution. The maximum value was
approximately 250HV.
The section of 18Cr-8Ni steel had a
hardness of approximately 180–190
HV. The hardness distribution of the
FJ dissimilar weld joints, prior to testing, is shown in Figure 9. The hardness
of the section of 9Cr-1Mo-V-Nb steel
was approximately 210 HV.
The hardness of the 310S steel section
showed 160HV. The maximum value
was approximately 250 HV at the part
of HAZ of 9Cr-1Mo-V-Nb steel.
The section of 304 steel had a hardness
of approximately 140 HV.
4.2 Relationship between tensile
properties and rupture location
The tensile strength of the GTAW dissimilar weld joint with those made
Figure 11 - Appearance of the GTAW dissimilar weld joint tensile specimens after tests
denoting change of fractured location with
temperature
from the 9Cr-1Mo-V-Nb steel [40]
and 18Cr-8Ni base metals are shown
in Figure 10. The tensile strength of
the GTAW dissimilar weld joints decreased with increasing temperature.
Figure 11 shows the appearance of the
specimen of GTAW dissimilar weld
joint, ruptured during the elevatedtemperature tensile test. At room temperature, the rupture occurred in the
buttering, whereas at 550 °C, the rupture occurred in the 18Cr-8Ni steel.
In contrast, at a temperature of 600
and 650 °C, the rupture occurred in
the 9Cr-1Mo-V-Nb. Thus, it was determined that the rupture location in
the elevated-temperature tensile test of
the dissimilar joints varied according
to the tensile strength of the base metal. The tensile strength of the friction
joints with those made from the 9Cr1Mo-V-Nb steel and 304 base metals
are shown in Table 4.
The tensile strength of the friction dissimilar joints decreased with increasing temperature. For the 309S joint,
the rupture occurred in the base metal
of 9Cr-1Mo-V-Nb steel side at room
temperature, at 600 °C and at 650 °C.
4.3 Relationship between long-term
creep rupture properties and
rupture location
4.3.1 GTAW weld joint
In this section, the creep rupture properties of the dissimilar weld joints and
the rupture location of all ruptured
specimens, after long-term exposure
to elevated temperature are described.
The stress-rupture time curves of the
dissimilar weld joints with the results
of the base metal specimen of 9Cr1Mo-V-Nb steel [40] are shown in Figure 12. The creep rupture strength of
the dissimilar weld joint specimen was
less than that of the base metal specimen at each temperature. Furthermore,
the differences in creep strength between the dissimilar weld joint and
base metal specimen tended to increase with increasing temperature.
Figure 13 shows the overall appearance
Figure 12 - Stress vs. rupture time curves
of the GTAW dissimilar weld joint and 9Cr1Mo-V-Nb base metal
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
675
M.Yamazaki et al. - Creep rupture properties and fracture type of 9Cr-1Mo-V-Nb/18Cr-8Ni steel dissimilar joints
Figure 13 - Fracture surface structures of a
creep-ruptured specimen at 550 °C, 160 MPa,
tR= 17 198 h
and the structure of a cross-section of a
ruptured region following the 550 °C,
160 MPa, and 17 198 h. There was no
significant deformation on the rupture
specimen and the rupture appeared to
be brittle. A flat fracture surface was
observed on each section [Figures 13
a), b), and c)]. In addition, the structure
of the ruptured region, examined under an optical microscope, occurred at
Figure 14 - Fracture surface structures of a
creep-ruptured specimen at 650 °C, 40 MPa,
tR = 27 536 h
the interface of the heat-affected zone
(HAZ) of the 9Cr-1Mo-V-Nb steel and
Inconel 82 in each case.
Figure 14 shows the overall appearance
of the specimen, the ruptured area, and
the structure of a cross-section of this
area under the 650 °C, 40 MPa, and 27
536 h. The rupture section appeared to
be strongly oxidized [Figures 14 a), b),
and c)] when observed under scanning
electron microscope (SEM). In addition,
an examination of the structure of the
ruptured area under the optical microscope showed that, in each case, the
rupture occurred in the fine-grained region of the heat-affected zone (HAZ)
of the 9Cr-1Mo-V-Nb steel.
Our results show that, at 550 °C, the
rupture location change from the base
metal of the 9Cr-1Mo-V-Nb steel to the
Figure 15 - Schematic of interface of the
GTAW dissimilar weld joint
Figure 16 - Stress vs rupture time curves of
dissimilar friction joints
676
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
Figure 17 - Stress vs rupture time curves of
dissimilar joints and 9Cr-1Mo-V-Nb steel
M.Yamazaki et al. - Creep rupture properties and fracture type of 9Cr-1Mo-V-Nb/18Cr-8Ni steel dissimilar joints
Figure 18 – Optical micrographs of HAZ of
9Cr-1Mo-V-Nb steel for dissimilar friction
joints
interface of the 9Cr-1Mo-V-Nb steel
and the Inconel 82, which is called a
combination failure, as the conditions
changed from high to low stress and
long- term exposure. The rupture location at 600 and 650 °C moved from the
base metal to the fine-grained region of
the 9Cr-1Mo steel HAZ. Furthermore,
the results of the microstructural observations, as shown in Figures 13 and
14, demonstrated that the cause of the
interfacial failure of the 9Cr-1Mo-VNb steel HAZ and the Inconel 82 steel,
which is a creep rupture resulting from
long-term exposure, 550 °C, and the
cause of the rupture in the fine-grained
region of 9Cr-1Mo-V-Nb steel HAZ,
which was the creep rupture resulting
from long-term exposure.
650 °C are considered as follows.
The 18Cr-8Ni steel side of the dissimilar weld joints appeared to have significantly hardened areas at their interfaces due to the heat cycle at the time of
the butt welding process. In contrast,
on the side made of 9Cr-1Mo-V-Nb
steel, the remaining stress of the interface area was removed due to the postweld heat treatment, which was conducted after buttering with Inconel 82.
Therefore, as shown in the schematic
of the dissimilar welding interfaces in
Figure 15, the creep deformation of the
interface area on the 9Cr-1Mo-V-Nb
steel side was larger than that on 18Cr8Ni steel side, and the shearing stress
exerted on the interface was greater,
accordingly. This can be the cause of
the rupture that occurred at the interface of the 9Cr-1Mo-V-Nb HAZ and
the Inconel 82,
creep rupture following long-term
at 550 °C.
However, the longterm creep rupture
test, at a temperature of 600 °C and
higher, showed that
the effect of cohesion and coarsening of carbide and
creep void generation in the finegrained
region
of the 9Cr-1Mo-V-Nb steel HAZ was
greater than that caused by the shearing stress, exerted at the interface area
of the 9Cr-1Mo-V-Nb steel.
It is possible that this resulted in the
rupture that occurred in the finegrained region of the 9Cr-1Mo-V-Nb
steel HAZ, i.e. creep rupture that occurred following a long term of exposure at a temperature of 650 °C.
4.3.2 Friction weld joint
Stress versus creep rupture time curves
for friction joints specimens are
shown in Figure 16.
Creep rupture strengths of the 309S
joint specimens were slightly lower
than those of the 310S joint specimens
at 600 and 650 °C. The stress-rupture
time curves of both the dissimilar weld
joints, friction joints and gas tungsten
arc welding (GTAW) joints, with the
results of the base metal specimen of
9Cr-1Mo-V-Nb steel are shown in Figure 17. The creep rupture strength of
the friction dissimilar joint specimen
was less than that of the base metal and
GTAW joints specimen at each temperature. Furthermore, the differences
in creep strength between the dissimilar welded joint and base metal specimen tended to increase with increasing
temperature.
4.3.3 Failure location and microstructure of the friction joint
Optical micrographs of the HAZ and
the 9Cr-1Mo-V-Nb base metal of the
friction joint for the virgin condition
are shown in Figure 18.
Two fine-grained parts are observed
in the HAZ, one adjacent to the base
metal [Figure 18 b)] and the other adjacent to the interface of insert metal
[Figure 18 d)]. The fine-grained part
in the HAZ adjacent to the interface
of insert metal formed during friction
joining process, strain hardening due
to upset pressure and recrystallization
by post-weld heat treatment.
Scan electron micrographs of creep
rupture specimen at 600 and 650 °C
are shown in Figure 19 and Figure 20,
respectively. The rupture of friction
joints occurred in the fine-grained region of the HAZ adjacent to the interface of insert metal of the 9Cr-1MoV-Nb steel. The schematic of the microstructure of friction welded joint is
Figure 19 – Scan electron micrographs of crept specimens for HAZ of dissimilar friction joint
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
677
M.Yamazaki et al. - Creep rupture properties and fracture type of 9Cr-1Mo-V-Nb/18Cr-8Ni steel dissimilar joints
Figure 20 – Scan electron micrographs and optical micrographs of crept specimens
shown in Figure 21. The fine-grained
part of the HAZ adjacent to the interface of insert metal formed during
friction joining process, dynamic
recrystallization.
4.4 Fracture type in dissimilar weld
joint specimen
Weld rupture types of similar and dissimilar weld joints are shown in the
schematic in Figure 22. Conventionally, the rupture types are classified as
Type I to Type IV [37-39], based on
the rupture location within the weld in
similar weld joints. Each type is defined as follows:
r Type I: Rupture that generates
cracks only in the weld metal.
r Type II: Rupture that generates
cracks across the range of the
weld metal and at the coarse region of base metal HAZ.
r Type III: Rupture that generates
cracks only in the coarse- grained
region of the base metal HAZ.
r Type IV: Rupture that generates
cracks only in the fine- grained
region of the base metal HAZ.
However, rupture locations differ
among dissimilar weld joints. Thus,
new classifications from Type V to
Figure 21 – Schematic of the microstructure
of dissimilar friction joint
Figure 23 – Fracture type map of GTAW
dissimilar weld joint
Figure 22 – Fracture type of similar and
dissimilar weld joints
678
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
Figure 24 – Relationship between long term
creep rupture strength and fracture type of
GTAW dissimilar weld joint
M.Yamazaki et al. - Creep rupture properties and fracture type of 9Cr-1Mo-V-Nb/18Cr-8Ni steel dissimilar joints
Type VII are defined expediently as
follows:
r Type V: Rupture that generates
cracks only in the base metal 9Cr1Mo-V-Nb steel.
r Type VI: Rupture that generates
cracks ranging from the interface
of the 9Cr-1Mo-V-Nb steel HAZ
and the Inconel 82, to the 9Cr1Mo-V-Nb steel HAZ and the
base metal 9Cr-1Mo-V-Nb steel.
r Type VII: Rupture that generates cracks at the interface of the
9Cr-1Mo-V-Nb steel HAZ and
the Inconel 82.
Figure 23 shows the fracture type of
the GTAW dissimilar weld joint specimen under temperature/stress treatments, determined by observing fracture surfaces.
At 550 °C and 240/200 MPa, the rupture was a Type VI. At 160 MPa, the
rupture was a Type VII.
At a temperature of 600 °C and stress
of 160 MPa, the rupture was a Type V,
and at less than 120 MPa, the rupture
was a Type IV.
Under lower stress, i.e., 80 MPa, the
rupture was a mixed fracture of Type
III and Type IV. At the high temperature, 650 °C, the rupture was a Type
IV. As shown above, and in the results
of this long-term creep rupture test, at
given temperatures and stress levels , it
has been determined that the fracture
type of dissimilar weld joints transformed from a type V to a type VII and
Type IV fractures.
Figure 24 shows the relationship be-
tween the creep rupture properties and
fracture type of the GTAW dissimilar
weld joints, which was estimated using the Larson-Miller parameter [41].
The fracture type of the GTAW dissimilar weld joints was predicted
Type IV fracture mode at 550 and
600 °C and at the rupture occurring
after 100 000 h. Mechanical properties
such as the creep rupture properties of
gas tungsten arc welding (GTAW) and
friction joining (FJ) dissimilar weld
joints were investigated under various
elevated temperature levels.
The findings are as follows:
1. The elevated temperature tensile
test on dissimilar weld joints demonstrated that the changes in the
rupture locations were dependent
upon the tensile strength of the
base metal.
2. Creep rupture strength of
the GTAW and FJ dissimilar
joint specimen was less than
that of the base metal specimen at all temperature levels.
In addition, the differences in
creep strength between the weld
joint and the base metal specimen
tended to be greater with increasing temperature.
3. At 550 °C, 160 MPa, 17 198 h,
the rupture specimen of GTAW
dissimilar weld joint fractured
at the interface between the
9Cr-1Mo-V-Nb steel HAZ and the
Inconel 82. It is believed that this
was caused by the shearing stress,
exerted at the interface.
4.
5.
6.
7.
8.
The fracture type of the GTAW
dissimilar weld joints observed in
the creep rupture test was transformed from a Type V, Type VII
fracture to a Type IV fracture
mode when increasing temperature and decreasing applied stress.
The fracture type of the GTAW
dissimilar weld joints was predicted Type IV fracture mode at 550
°C and 600 °C and at the rupture
occurring after 100 000 h.
Two fine-grained parts were observed in the HAZ, one adjacent
to the base metal and the other
adjacent to the interface of insert
metal of dissimilar joint by friction joining.
The rupture of friction dissimilar
joints occurred in the fine-grained
region of the HAZ adjacent to the
interface of insert metal of the
9Cr-1Mo-V-Nb steel.
The fine-grained of the HAZ adjacent to the interface of insert
metal formed during friction joining process, dynamic recrystallization.
Acknowledgements
This experiment was funded by a grant
from the Nuclear Research Fund, established by The Ministry of Education, Culture, Sports, Science, and
Technology, on behalf of the Atomic
Energy Board.
References
[1]
[2]
[3]
[4]
[5]
Masuyama F.: Creep rupture life and design factors for high-strength ferritic steels, International Journal of Pressure Vessels and Piping, 2007, Vol. 84, no. 1-2, pp. 53-61.
Abe F.: Heat-to-heat variation in long-term creep strength of some ferritic steels, International Journal of Pressure
Vessels and Piping, 2010, Vol. 87, no. 6, pp. 310-318.
Kaybyshev R.O., Skorobogatykh V. N. and Shchenkova I. A.: New martensitic steels for fossil power plant: Creep
resistance, The Physics of Metals and Metallography, 2010, Vol. 09, no. 2, pp. 186-200.
Cheon J. S., Lee C. B., Lee B. O., Raison J. P., Mizuno T., Delage F. and Carmack J.: Sodium fast reactor evaluation, Core materials, Journal of Nuclear Materials, 2009, Vol. 392, no. 2, pp. 324-330.
Wilshire B. and Scharning P. J.: Long-term creep life prediction for a high chromium steel, Scripta Materialia, 2007,
Vol. 56, no. 8, pp. 701-704.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
679
M.Yamazaki et al. - Creep rupture properties and fracture type of 9Cr-1Mo-V-Nb/18Cr-8Ni steel dissimilar joints
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
680
Sket F., Zieciol K. D., Borbely A., Kaysser-Pzalla A. R., Maile K. and Scheck R.: Microtomographic investigation
of damage in E911 steel after long term creep, Materials Science and Engineering: A, 2010, Vol. 528, no. 1,
pp. 103-111.
Kabadwal A., Tamura M., Shinozuka K. and Esaka H.: Recovery and precipitate analysis of 9Cr-1MoVNb steel
during creep, Metallurgical and Materials Transactions A: Physical Metallurgy and Materials Science, 2010, Vol.
41, no. 2, pp. 364-379.
Kimura K., Kushima H. and Sawada K.: Long-term creep deformation property of modified 9Cr-1Mo steel,
Materials Science and Engineering: A, 2009, Vol. 510-11, pp. 58-63.
Yoshizawa M., Igarashi M., Moriguchi K., Iseda A., Armaki H. G. and Maruyama K.: Effect of precipitates on
long-term creep deformation properties of P92 and P122 type advanced ferritic steels for USC power plants,
Materials Science and Engineering: A, 2009, Vol. 510-11, pp. 162-168.
Armaki H. G., Chen R., Maruyama K. and Igarashi M.: Premature creep failure in strength enhanced high Cr ferritic
steels caused by static recovery of tempered martensite lath structures, Materials Science and Engineering: A, 2010,
Vol. 527, no. 24-25, pp. 6581-6588.
Keller C., Margulies M. M., Hadjem-Hamouche Z. and Guillot I.: Influence of the temperature on the tensile behaviour of modified 9Cr-1Mo T91 martensitic steel, Materials Science and Engineering: A, 2010, Vol. 527, no. 24-25,
pp. 6758-6764.
Chandravathi K. S., Laha K., Bhanu Sankara Rao K. and Mannan S. L.: Microstructure and tensile properties of
Modified 9Cr-1Mo steel (grade 91), Materials Science and Technology, 2001, Vol. 17, no. 5, pp. 559-565.
Sawada K., Suzuki K., Kushima H., Tabuchi M. and Kimura K.: Effect of tempering temperature on Z-phase formation and creep strength in 9Cr-1Mo-V-Nb-N steel, Materials Science and Engineering: A, 2008, vol. 480, no.
1-2, pp. 558-563.
Kocer C., Abe T. and Soon A.: The Z-phase in 9-12% ferritic steels: A phase stability analysis, Materials Science
and Engineering: A, 2009, Vol. 505, no. 1-2, pp. 1-5.
Storesund J. and Tu S.-T: Geometrical effect on creep in cross weld specimens, International Journal of Pressure
Vessels and Piping, 1995, Vol. 62, no. 2, pp. 179-193.
Tu S.-T., Segle P. and Gong J.-M.: Strength design and life assessment of welded structures subjected to high temperature creep, International Journal of Pressure Vessels and Piping, 1996, Vol. 66, no. 1-3, pp. 171-186.
Segle P., Tu S.-T., Storesund J. and Samuelson L. A.: Some issues life assessment of longitudinal seam welds based
on creep tests with cross-weld specimens, International Journal of Pressure Vessels and Piping, 1996, vol. 66, no.
1-3, pp. 199-222.
Eggeler G., Romteke A., Coleman M., Chew B., Peter G., Burblies A., Hald J., Jefferey C., Rantala J., deWitte M.
and Mohrmann R.: Analysis of creep in a welded “P91” pressure vessel, International Journal of Pressure Vessels
and Piping, 1994, Vol. 60, no. 3, pp. 237-257.
Parker J.: Creep and fracture behaviour of English Electric Mark III transition welds part (b) Ex-service weldments,
International Journal of Pressure Vessels and Piping, 1998, Vol. 75, no. 2, pp. 95-103.
Tabuchi M., Watanabe T., Kubo K., Matsui M., Kinugawa J. and Abe F.: Creep crack growth behavior in the HAZ
of weldments of W containing high Cr steel, International Journal of Pressure Vessels and Piping, 2001, Vol. 78, no.
11-12, pp. 779-784.
Matsui M., Tabuchi M., Watanabe T., Kubo K., Kinugawa J. and Abe F.: Degradation of Creep Strength in Welded
Joint of 9%Cr Steel, ISIJ International, 2001, Vol. 41, Supplement, pp. 126-130.
Spigarelli S. and Quadrini E.: Analysis of the creep behaviour of modified P91 (9Cr-1Mo-NbV) weld, Materials and
Design, 2002, Vol. 23, no. 6, pp. 547-552.
Albert S. J., Kondo M., Tabuchi M., Yin F., Sawada K. and Abe F.: Improving the creep properties of 9Cr-3W3Co-NbV steels and their weld joints by the addition of boron, Metallurgical and Materials Transactions A:
Physical Metallurgy and Materials Science, 2005, vol. 36, no. 2, pp. 333-343.
Chellapandi P., Chetal S. C. and Raj B.: Assessment of ½d approach for creep damage estimation of FBR components with crack like defect at welds, International Journal of Pressure Vessels and Piping, 2005, vol. 82, no. 10, pp.
739-745.
Chellapandi P., Srinivasan R., Chetal S. C. and Raj B.: Experimental creep life assessment of tubular structures with
geometrical imperfections in welds with reference to fast reactor plant life, International Journal of Pressure Vessels
and Piping, 2006, Vol. 83, no. 7, pp. 556-564.
Auerkari P., Holmström S., Veivo J. and Salonen J.: Creep damage and expected life for welded 9-11% Cr steels,
International Journal of Pressure Vessels and Piping, 2007, vol. 84, no. 1-2, pp. 69-74.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
M.Yamazaki et al. - Creep rupture properties and fracture type of 9Cr-1Mo-V-Nb/18Cr-8Ni steel dissimilar joints
[27] Holmström S. and Auerkari P.: Predicting weld creep strength reduction for 9% Cr steel, International Journal of
Pressure Vessels and Piping, 2006, Vol. 83, no 11-12, pp. 803-808.
[28] Allen D. J., Harvey B. and Brett S. J.: “FOURCRACK”: An investigation of the creep performance of advanced
high alloy steel welds, International Journal of Pressure Vessels and Piping, 2007, Vol. 84, no. 1-2, pp. 104-113.
[29] Nonaka I., Ito T., Takemasa F., Saitou K., Miyachi Y. and Fujita A.: Full size internal pressure creep test for welded
P91 hot reheat elbow, International Journal of Pressure Vessels and Piping, 2007, Vol. 84, no. 1-2, pp. 97-103.
[30] Sawada K., Tabuchi M., Hongo H., Watanabe T. and Kimura K.: Z-Phase formation in welded joints of high chromium ferritic steels after long-term creep, Materials Characterization, 2008, Vol. 59, no. 9, pp. 1161-1167.
[31] Ogata T., Sakai T. and Yaguchi M.: Damage characterization of a P91 steel weldment under uniaxial and multiaxial
creep, Materials Science and Engineering: A, 2009, Vol. 510-511, pp. 238-243.
[32] Tabuchi M., Hongo H., Li Y., Watanabe T. and Takahashi Y.: Evaluation of microstructures and creep damages in
the HAZ of P91 steel weldment, Journal of Pressure Vessel Technology, 2009, Vol. 131, no. 2, pp. 1-6.
[33] Arivazhagan B., Prabhu R., Albert S. K., Kamaraj M. and Sundaresan S.: Microstructure and Mechanical properties of 9Cr-1Mo steel weld fusion zones as a function of weld metal composition, Journal of Materials Engineering
and Performance, 2009, Vol. 18, no. 8, pp. 999-1004.
[34] Li Y., Hongo H., Tabuchi M., Tkahashi Y. and Monma Y.: Evaluation of creep damage in heat affected zone of thick
welded joint for Mod.9Cr-1Mo steel, International Journal of Pressure Vessels and Piping, 2009, Vol. 86, no. 9, pp.
585-592.
[35] Sawada K., Bauer M., Kauffmann F., Mayr P. and Klenk A.: Microstructural change of 9% Cr-welded joints after
long-term creep, Materials Science and Engineering: A, 2010, Vol. 527, no. 6, pp. 1417-1426.
[36] Masuyama F.: Creep degradation in welds of Mod. 9Cr-1Mo steel, International Journal of Pressure Vessels and
Piping, 2006, Vol. 83, no. 11-12, pp. 819-825.
[37] Albert S. K., Matsui M., Watanabe T., Hongo H., Kubo K. and Tabuchi M.: Variation in the Type IV cracking behaviour of high Cr steel weld with post-weld heat treatment, International Journal of Pressure Vessels and Piping,
2003, Vol. 80, no. 6, pp. 405-413.
[38] Spindler S. L., Allen D. J., Baker A. J. and Spindler M. W.: Analysis of cross-weld creep rupture data on the 1/2Cr1/2Mo-1/4V Type IV zone, International Journal of Pressure Vessels and Piping, 2010, Vol. 87, no. 6, pp. 296-303.
[39] Laha K., Chandravathi K. S., Parameswaran P., Bhanu Sankara Rao K. and Mannan S. L.: Characterization of microstructures across the heat–affected zone of the modified 9Cr-1Mo weld joint to understand its role in promoting
Type IV cracking, Metallurgical and Materials Transactions A: Physical Metallurgy and Materials Science, 2007,
Vol. 38, no.1, pp. 58-68.
[40] NRIM Creep Data Sheet, no. 43, NRIM, Tsukuba, 1996, URL; http://mits.nims.go.jp
[41] Larson F. R. and Miller J.: A time-temperature relationship for rupture and creep stresses, Transactions of the
ASME 74, 1952, pp. 765-775.
About the authors
Mr. Masayoshi YAMAZAKI ([email protected]), Mr. Takashi WATANABE ([email protected]),
Dr. Hiromichi HONGO ([email protected]) and Dr. Masaaki TABUCHI ([email protected]) are
all with National Institute for Materials Science, Tokyo (Japan).
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
681
FONTARGEN
COMPETENZA SULLA BRASATURA
Ogni volta che c‘è da unire metalli nel modo più efficiente Fontargen è il vostro
partner, offrendo una gamma completa di prodotti brasanti dalle bacchette di rame
e argento, nude e rivestite, fili, fino alle polveri, paste e disossidanti. Aziende di
tutto il mondo si affidano alla nostra consulenza, al know-how tecnologico e alla
qualità di prodotti realizzati in Germania.
www.boehlerweldinggroup.com
IIS Didattica
Introduzione al processo di saldatura al plasma
Introduzione al processo
di saldatura al plasma *
1. Introduzione
Per quanto il processo al plasma sia
tuttora (erroneamente) considerato di
recente sviluppo, è significativo ricordare che l’arco plasma è stato storicamente messo a punto in Germania,
nel lontano 1909, dal fisico Schonner
presso la BASF (Badische Anilin und
Soda Fabrik).
Da quel tempo, il processo ha raggiunto una notevole maturità sia nelle applicazioni rivolte alla saldatura che per
quelle finalizzate ai riporti superficiali,
per quanto non abbia forse raggiunto
la diffusione che sarebbe stato lecito
attendersi.
2.
Caratteristiche dell'arco
plasma
Facendo riferimento alla pubblicazione dedicata all’arco elettrico per
impiego in saldatura, si dà il nome di
plasma ad un gas i cui atomi sono stati
fortemente ionizzati: in queste condizioni il gas diviene conduttore della
corrente elettrica.
Il plasma per le applicazioni qui considerate viene ottenuto facendo passare
un flusso del gas da ionizzare (generalmente un gas inerte) attraverso un arco
elettrico strozzato: tale strozzatura è
realizzata mediante un'opportuna diaframmatura dell'ugello della torcia.
La diaframmatura realizza una sorta di
concentrazione del fascio, con conseguente aumento dei suoi effetti termici, per cui nel plasma si raggiungono
temperature molto più elevate (circa
20.000 °C) di quelle che si hanno in un
arco libero (sino a 12.000 °C).
Non si può parlare propriamente di
focalizzazione del fascio di atomi ionizzati in modo analogo a quello che si
ha nel fascio di elettroni o di fotoni. Il
principio dell'arco - plasma è illustrato
*
nella Figura 1. La torcia è costituita da
una camera cilindrica in corrispondenza del cui asse viene fissato un elettrodo di tungsteno.
Nella parte inferiore della torcia una
punta speciale energicamente raffreddata a circolazione d'acqua, con un
foro di diametro normalmente minore
di quello dell'elettrodo, crea la strozzatura dell'arco.
Si può utilizzare un foro cilindrico con
elettrodo in posizione interna che dà
luogo ad un arco più rigido (Fig. 2, a
sinistra) normalmente per le intensità
Redazione a cura della Divisione Formazione
dell’Istituto Italiano della Saldatura, Genova.
di corrente più basse, oppure un foro
conico divergente ed elettrodo più interno ed un arco più morbido (Fig. 2, a
destra). L'arco elettrico, che provvede
alla ionizzazione del gas, è alimentato
da un generatore di corrente continua a
caratteristica cadente e può scoccare:
r fra l'elettrodo ed il materiale da
saldare (Fig. 3a): in questo caso si
ha un "arco trasferito", usato con i
materiali metallici per la saldatura
ed il taglio;
r fra l'elettrodo e la punta plasma
(Fig. 3b): in questo caso si ha
un "arco non trasferito", che può
essere utilizzato su materiali non
metallici e per microsaldature, il
suo rendimento energetico è infatti molto basso.
Il gas entra lateralmente nella parte
superiore della torcia e subisce la dissociazione ionica attraversando l'arco;
questo fenomeno è particolarmente
intenso nella zona centrale dell'arco,
ove viene conseguita una dissociazione pressoché completa e dove si raggiungono altissime temperature: per
tale motivo è realizzato un energico
raffreddamento della torcia con circolazione d'acqua.
Figura 1 - Rappresentazione del principio
dell’arco - plasma
Figura 2 - Geometria della torcia per la saldatura plasma
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012 683683
Introduzione al processo di saldatura al plasma
Figura 3 - Plasma con arco trasferito (a) e
non trasferito (b)
Il gas, per effetto dell'elevato innalzamento termico, ha la tendenza ad
espandersi: la strozzatura della torcia
dà luogo quindi ad un aumento della velocità di uscita del gas ionizzato
(qualche migliaio di m/s) che forma
quindi un fascio di ioni ad energia concentrata (plasma-jet).
3.
Apparecchiature per la
saldatura al plasma
3.1 Generalità
Le apparecchiature per la saldatura
ad arco plasma differiscono a seconda che si tratti di apparecchiature per
la saldatura con arco trasferito o non
trasferito e che si tratti di saldatura manuale o automatica.
La saldatura manuale con arco trasferito viene generalmente usata con basse
intensità di corrente e sostituisce efficacemente il processo TIG (Fig. 4).
L'arco plasma infatti consente l'uso di
archi stabili anche con ridotte intensità
di corrente con un migliore controllo
della distanza torcia-pezzo e della penetrazione.
Esistono apparecchiature di microplasma particolarmente adatte per
elementi assai sottili (fili, lamierini di
0,1÷1,0 mm di spessore) che permettono l'uso di correnti estremamente
basse (anche fino a 0,1 A) con flusso
di plasma ancora molto stabile e direzionale (molto di più di quello dell'arco TIG che, per correnti molto basse,
ad esempio inferiori a 5 A, non risulta
sufficientemente stabile).
Le apparecchiature per la saldatura
al plasma a "forte penetrazione" (con
arco trasferito - plasma-jet), cioè con
formazione di foro di penetrazione (o
keyhole) sono generalmente costituite
da torce montate su teste per saldatura
automatica. Ciò è necessario perché,
per mantenere il foro di penetrazione,
occorre una particolare costanza della
velocità di avanzamento, del posizionamento (direzione) e della distanza
torcia-pezzo, difficilmente realizzabili
in saldatura manuale o semiautomatica. L'apparecchiatura per saldatura a
forte penetrazione prevede inoltre programmi di variazione della portata del
gas e della corrente dell'arco in salita
o in discesa per la corretta formazione
e rispettivamente chiusura del keyhole.
In caso contrario diviene praticamente
impossibile evitare difetti di estremità
per cui il processo va usato solo per
giunti non circonferenziali e muniti di
talloni di estremità.
3.2 Torce
Dei principali tipi di torce per saldatura al plasma si è già fatto cenno. A
quanto detto va aggiunto che al circuito elettrico principale di saldatura é
generalmente aggiunto un circuito ausiliario che fornisce un arco pilota con
corrente continua a bassa intensità ed
innesco ad alta frequenza, non trasferito, che scocca fra elettrodo e ugello
della torcia. L'arco pilota serve a mantenere una sufficiente ionizzazione del
Figura 4 - Confronto TIG - Plasma
684684 Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
mezzo e a facilitare l'innesco della formazione del plasma all'atto della saldatura. L'arco pilota viene automaticamente disinserito dopo l'accensione
dell'arco per saldatura.
Esiste parimenti un circuito ausiliario
che serve a mantenere, per un certo
tempo, il flusso di gas inerte dopo l'estinzione dell'arco per saldatura: detto
flusso serve a proteggere dall'ossidazione l'elettrodo di tungsteno toriato e le pareti interne dell'ugello della
torcia, mantenendoli più a lungo in
buone condizioni operative e facilitando il reinnesco dell'arco di saldatura. L'elettrodo di tungsteno, pertanto (molto spesso tungsteno toriato,
ceriato o lantaniato) risulta molto più
protetto nelle torce plasma dalle contaminazioni che non nelle torce TIG.
L'elettrodo nelle torce plasma può,
infatti, funzionare per parecchie ore
prima di richiedere la ravvivatura della
punta. Molto importanti sono inoltre i
circuiti di raffreddamento delle torce,
generalmente ad acqua e in particolare
dell'ugello delle stesse; detto raffreddamento forzato è indispensabile date
le elevate temperature raggiunte dal
flusso di gas ionizzato.
L'acqua generalmente è demineralizzata, per evitare depositi nelle torce e
viene fatta circolare in circuito chiuso.
La presenza di tutti questi circuiti e
le elevate sollecitazioni termiche cui
Introduzione al processo di saldatura al plasma
Figura 5 - Torcia plasma raffreddata ad aria
d'arco in un campo abbastanza vasto,
ad esempio fino a 20 mm senza comprometterne la stabilità) si fa spesso
uso di generatori a caratteristica verticale, praticamente a corrente costante,
ottenuta con regolazione elettronica.
Possono quindi essere vantaggiosamente usati generatori a controllo elettronico. Negli altri casi possono ancora essere usati generatori di tale tipo
oppure saldatrici a raddrizzatori con
controllo elettronico, o ad onde quadre, ecc. Oltre al generatore di corrente
l'impianto è costituito da un quadro di
controllo e comando per la regolazione
delle sequenze di saldatura e dei parametri:
r innesco arco pilota;
r discesa della torcia (per saldatura
automatica);
r innesco arco saldatura;
r corrente di innesco e di saldatura,
gas plasma;
r fine ciclo, spegnimento arco;
r discesa corrente;
r riduzione gas;
r comando e arresto movimenti filo
d'apporto e traslazione torcia o
pezzo.
L'impianto prevede inoltre i dispositivi di sicurezza del gas ed acqua di
raffreddamento ed eventualmente i
Figura 6 - Torcia plasma raffreddata ad
acqua
sono soggette rendono pertanto le torce al plasma più voluminose e ingombranti delle corrispondenti torce MIG
o TIG: è dunque importante valutare
per determinate applicazioni anche le
condizioni di accessibilità al giunto.
Non va infine trascurata la necessità di
un’accurata manutenzione.
3.3
Generatori ed impianti di
saldatura
Come detto in precedenza, vengono
usati quasi esclusivamente generatori di corrente continua: l'elettrodo di
tungsteno toriato è di norma posto al
polo negativo (CCPD / DCEN) per
prolungarne la durata. Nel caso delle
saldatrici a microplasma (per le quali, a bassissimi valori di corrente, è
importante poter variare la lunghezza
Figura 7 - Un moderno impianto per saldatura plasma (cortesia Linde - Sciaky)
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012 685685
Introduzione al processo di saldatura al plasma
comandi per la pulsazione di corrente.
Negli impianti per saldatura plasma
automatici esiste quasi sempre un controllo di posizione della torcia sull'asse
verticale tramite la tensione dell'arco.
Una slitta motorizzata verticale asservita alla tensione dell'arco di saldatura
consente di garantire una distanza costante tra la torcia ed il pezzo: si ottiene in tal modo una penetrazione praticamente costante.
L'impiego del processo plasma quindi
è consigliabile soprattutto nelle applicazioni automatiche o completamente
automatizzate, ove il maggior costo di
investimento viene compensato dalla
maggiore produttività (Fig. 7).
In confronto con il processo TIG, con
l'arco plasma si possono saldare (nel
caso degli acciai al carbonio) spessori
oltre i 3 mm e fino a 10 mm circa, in
una sola passata a lembi retti e con un
limitato consumo di filo d'apporto.
3.4 Gas
Nella saldatura al plasma occorre distinguere tra il gas usato per creare il
plasma e il gas di protezione. Infatti il
primo esce dall'ugello con troppa violenza e turbolenza per assicurare una
protezione efficace.
Il gas usato per la formazione del plasma in saldatura é generalmente l'argon che, con il suo basso potenziale di
ionizzazione, assicura facile innesco
dell'arco e un arco pilota stabile. Esso
inoltre fornisce un getto di plasma stabile e un'ottima protezione all'elettrodo di tungsteno. Talvolta vengono effettuate moderate aggiunte di idrogeno
(fino al 5% H2) all'argon per creare un
maggior trasferimento termico (dissociazione e ri-associazione dell'H2)
particolarmente nella saldatura a forte
penetrazione. La portata del gas per il
plasma varia, di solito, da 2 a 10 l/min.
I gas usati per la protezione del bagno
sono analoghi a quelli per la saldatura
TIG: argon, elio, miscele di argon-elio
e miscele di argon-idrogeno.
Le miscele sono di solito usate per rendere il bagno più fluido ed evitare incisioni marginali, accrescendo l'apporto
termico per unità di superficie.
In particolare l'idrogeno (variabile
dall'1 al 15%) permette di accrescere
la velocità di saldatura e limita le ossidazioni e le porosità nelle leghe a
base di Ni e negli acciai inossidabili
al Cr-Ni. L'elio aumenta pure l'apporto termico a causa del suo potenziale
di ionizzazione più elevato ed è usato
generalmente per saldatura di materiali ad elevata conducibilità termica
tipo leghe di Al e Cu. In miscela con
l'argon (ad esempio 75% He - 25% Ar)
viene usato per forti spessori di titanio
o rame: l'argon nella miscela ha il vantaggio di stabilizzare l'arco, mentre l'elio accresce l'apporto energetico.
La portata dell'argon e delle miscele
a base di argon per la protezione del
bagno varia, di solito, da 4,5 a 9 l/min.
L'elio, solo o in miscela con l'argon,
richiede invece portate assai maggiori
(15÷30 l/min).
3.5 Materiali d'apporto
Nel caso di saldature al plasma a media o forte intensità di corrente si usano
generalmente materiali che vengono
apportati al bagno come nel processo
TIG manuale o automatico.
Anche i fili sono gli stessi considerati
nel processo TIG, cui si rimanda. La
quantità di filo da apportare é generalmente minore (a parità di altre condizioni) di quella che si ha nel processo
TIG, particolarmente se si usa il metodo a forte penetrazione (keyhole) per
cui l'apporto serve soprattutto per formare il sovrametallo; il filo di apporto
non é infatti usato nella prima passata
a forte penetrazione di saldature multipass.
3.6 Ulteriori considerazioni
Nel complesso deve essere tenuto presente che le apparecchiature per la saldatura al plasma sono in generale abbastanza complesse e quindi delicate.
Pertanto, come precedentemente già
detto, la saldatura ad arco plasma trova le sue maggiori applicazioni nella
versione automatica o completamente
automatizzata, potendo sfruttare in tal
modo le elevate prestazioni del processo e semplificare con l'automatizzazione le più complesse sequenze di
lavoro.
Una maggiore cura deve anche essere
richiesta nella manutenzione e con-
686686 Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
duzione degli impianti per evitare che
eventuali perdite dei fluidi (gas e acqua) possano alterare il risultato finale.
Il personale addetto alle manutenzioni
delle saldatrici, torce e pannelli di controllo deve essere inoltre particolarmente esperto.
Per le applicazioni manuali, invece,
l'apprendimento del saldatore è più
facile rispetto al caso del TIG data la
maggiore stabilità, elasticità e direzionalità dell'arco plasma.
4.
Modalità di saldatura e
applicazioni
Nella descrizione del processo si é già
accennato alle diverse modalità di saldatura; per dare un quadro organico si
possono distinguere qualitativamente
modalità a bassa, media o ad elevata
intensità di corrente.
4.1
Modalità di saldatura a bassa
corrente
Si intendono tali correnti inferiori a
15 A, che includono pertanto il cosiddetto microplasma, che può giungere
fino a 0,1 A.
Hanno il principale vantaggio che con
l'energia concentrata del plasma e la
maggiore stabilità d'arco si possono
saldare spessori molto sottili (fino a
0,1÷0,3 mm) dei diversi materiali,
senza sfondamenti, con buon controllo
dell'arco e del bagno e con distorsioni
assai limitate. Spesso si usano preparazioni a bordi rilevati per spessori inferiori a 0,3 mm.
La saldatura può essere manuale (ad
esempio, la saldatura di reti, di filtri,
di elementi di pressostati, la puntatura
di accessori anche in posizione difficile), effettuabile in tutte le posizioni,
o automatica (saldatura di lamierini,
saldatura longitudinale di tubi, ecc.),
effettuata generalmente in piano.
Un esempio dei parametri usati per la
saldatura a bassa corrente può essere il
seguente:
r gas plasma: argon;
r corrente: 10÷15 A;
r gas di protezione: Ar + 2% H2;
r diametro ugello della torcia:
0,8 mm.
Per spessori molto sottili in saldatura
Introduzione al processo di saldatura al plasma
4.3
Figura 8 - Torcia per saldatura microplasma
(cortesia COMATEC)
automatica esiste pure la versione del
microplasma ad arco pulsato (Fig. 8).
4.2
Modalità di saldatura a media
corrente
Si intendono quelle con corrente da 15
a 100 A. Con queste modalità il processo al plasma può essere considerato
come un'estensione del processo TIG,
e risulta conveniente ove il maggior
costo sia compensato dalla maggiore
elasticità del processo.
Si usano infatti, di regola, le stesse preparazioni del processo TIG.
La saldatura di solito è effettuata in
manuale, in tutte le posizioni, salvo in
certi casi (in cui risulta preferibile la
saldatura automatica per effetto delle
maggiori correnti), nei quali è applicata solo in piano; può essere usata per la
saldatura, anche circonferenziale, dei
tubi; in certe applicazioni elettromeccaniche su motori elettrici; in costruzioni automobilistiche, etc.
Dato il vantaggio della bassissima contaminazione dell'elettrodo, la saldatura
al plasma ha riscosso un certo successo
nella saldatura degli acciai al carbonio
o basso-legati in applicazioni automatiche o completamente automatizzate
in quanto il maggior peso e ingombro
della torcia sono un non indifferente svantaggio. Nel caso di saldatura a
media intensità merita inoltre di essere
menzionata la modalità di saldatura al
plasma a corrente pulsante, nella quale
un rapido impulso provoca la penetrazione nel materiale, mentre il successivo tempo a corrente più bassa permette
al bagno di solidificare in parte senza
sfondamenti. La saldatura assume
quindi il carattere di tanti punti successivi parzialmente sovrapposti.
Modalità di saldatura ad
elevata corrente
Possono essere considerate tali quelle superiori a 100 A (di solito, fino a
180÷200 A).
Tenendo conto della maggiore concentrazione della sorgente termica va
considerato che una corrente di 100 A
nel processo plasma, può considerarsi
"equivalente" ad una da 200 A nel caso
di arco TIG, (Fig. 9).
In queste modalità di saldatura si possono distinguere le due forme:
r saldatura a plasma con trasmissione del calore per contatto diretto,
detto “palsma dolce" (melt-in);
r
saldatura con trasmissione del calore per contatto diretto, detto “a
forte penetrazione" (keyhole).
La prima può ancora essere usata in
forma manuale anche se il peso della
torcia rende la tecnica più difficoltosa, la seconda è usata sempre in forma
automatica o completamente automatizzata. Il maggiore vantaggio della
saldatura a forte penetrazione si ha nel
caso di spessori saldati in una sola passata, estendendosi il keyhole all'intero
spessore da saldare (Fig. 10).
Si ottengono così una forma di giunto
profonda e molto stretta, limitate distorsioni e velocità di saldatura relativamente elevate.
La preparazione a lembi retti accostati e il consumo di materiale d'apporto
(filo alimentato lateralmente alla torcia) è assai ridotto.
Dato tuttavia che il getto di plasma é
concentrato ma non "focalizzato" su
piccole macchie focali, limitando così
l'energia specifica per mm2 di superficie del pezzo da saldare, la profondità
del keyhole, che si può ottenere col
processo plasma, è limitata e non supera in genere 6÷10 mm.
Inoltre nella saldatura con keyhole a
partire da 3 mm è consigliabile usare all'inizio ed alla fine dei talloni di
estremità sui quali verrà lasciato il
foro.
Per una migliore comprensione dell'effetto dei parametri di saldatura nei
confronti della formazione del keyho-
Figura 9 - Arco plasma ad elevata corrente
(Argon, 150 A, 28 V)
Figura 10 - Esempio di saldatura plasma keyhole di leghe di alluminio
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012 687687
Introduzione al processo di saldatura al plasma
Figura 11 - Effetto della velocità di saldatura e della corrente sulla formazione del keyhole (Plasma gas: 1.3 l/min, diametro ugello: 1.57 mm;
A - Velocità 2 mm/s, corrente 60 A; B - Velocità 2 mm/s, corrente 65 A; C - Velocità 1.8 mm/s, corrente 70 A; D - Velocità 1.6 mm/s, corrente 75 A)
Figura 12 - Esempio di corrente ad onda
quadra per saldatura plasma keyhole di
leghe di alluminio
le è possibile analizzare la Figura 11,
unitamente al dettaglio dei parametri
impiegati nei diversi casi descritti.
Per materiali sensibili all'ossidazione
è inoltre opportuna una protezione al
rovescio ottenuta con una barra scanalata, avente dimensioni di scanalatura
abbastanza ampie in modo da permettere l'evacuazione dei gas plasma.
Il processo a forte penetrazione (con
keyhole) è generalmente usato in piano: con opportuni accorgimenti può
anche essere usato in frontale o in verticale ascendente.
Problemi particolari pone la saldatura
plasma di alluminio e sue leghe con
l'uso della corrente continua: in modo
analogo alla saldatura TIG, occorre
rompere la pellicola superficiale d'ossido; per superare tale difficoltà sono
stati elaborati generatori speciali a polarità variabile e ad onde quadre (Fig.
12) che possono essere programmati
alternativamente con polo positivo o
negativo sul pezzo.
In pratica, occorre una corrente di
Figura 13 - Saldatura di lamiere di alluminio
(tecnica keyhole, spessore 5mm)
circa 70 A di polarità inversa (polo
sul pezzo) per frantumare la pellicola
d'ossido addizionata ad una corrente di
140÷180 A di polarità diretta per creare il foro di penetrazione su spessori di
circa 6 mm (Fig. 13).
Applicazioni tipiche sono le saldature
longitudinali di tubi saldati di diversi
materiali (acciai al carbonio o bassolegati, acciai inossidabili, nichel e sue
leghe, titanio e sue leghe, ecc.) o di apparecchi di serie, nei quali la maggior
velocità di saldatura (che può superare
i 50 cm/min) compensa la maggiore
spesa per l'accuratezza delle preparazioni ed il maggior costo delle apparecchiature.
Relativamente alle tolleranze delle
preparazioni, esse risultano assai critiche per il processo e la tecnica keyhole in particolare: a titolo di esempio,
per spessori tra 2.5 e 4 mm si possono
considerare accettabili slivellamenti
tra 0.4 ed 1 mm (con luci comprese
tra 0.5 ed 1 mm), per spessori maggiori di 4 mm slivellamenti massimi
688688 Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
tra 1 e 1.5 mm (con luci di 1.5 mm
circa). Nella Tabella 1 sono riportati
alcuni esempi invece di parametri impiegabili per la saldatura di lamiere di
acciaio inossidabile con materiale di
apporto, mentre la Tabella 2 riporta un
esempio di parametri per la saldatura
di lamiere di titanio a forte penetrazione (keyhole). Il processo di saldatura
al plasma, nella versione automatica,
può essere usato pure per saldature a
passate multiple di giunti di spessore
maggiore; in essi, di solito, la prima
passata è fatta a forte penetrazione:
la preparazione deve pertanto essere
adatta al metodo del keyhole.
Spesso si usa una preparazione a Y
con spalla di 5 mm e angolo di 75°.
Le passate successive sono fatte riducendo l'intensità del getto di plasma e
passando al tipo di plasma dolce (meltin) con metallo d'apporto.
Pertanto, occorre aver cura nello studio
della preparazione dei lembi e dell'accessibilità per tenere conto delle non
trascurabili dimensioni della torcia
Introduzione al processo di saldatura al plasma
TABELLA 1 - Parametri impiegabili per la saldatura al plasma di lamiere di acciaio inossidabile con materiale di apporto (esempi)
Filo consumabile
Spessore
[mm]
Corrente
[A]
Tensione
[V]
Velocità
[cm/min]
2
120
25÷27
3
130÷140
4
Gas
Diametro
[mm]
Velocità
[cm/min]
Plasma
[Ar o Ar 2% H2]
Protezione
[Ar o Ar 5% H2]
65
1
60
2÷3
15
25÷28
45÷50
1
50
3÷4
15÷20
150÷160
25÷28
35÷28
1.2
60
4÷5
15÷20
5
150÷160
25÷28
28÷32
1.2
60
4.5÷6
20÷25
6
250÷270
24÷26
26÷30
1.2
60
8÷9
20÷30
8
250÷280
24÷26
18÷20
1.2
90
8÷10
25÷30
TABELLA 2 - Parametri impiegabili per la saldatura plasma di lamiere di titanio con tecnica
keyhole (esempi)
plasma. Le applicazioni di saldatura a
passate multiple sono tuttavia limitate
e vanno, di regola, fino a spessori di
circa 10 mm su acciai inossidabili e 15
mm su titanio, saldati generalmente in
piano. La passata a forte penetrazione
permette velocità di avanzamento di
30÷40 cm/min mentre la (o le) passate
di riempimento sono fatte, di solito, a
velocità di 20÷25 cm/min.
Un'altra versione del processo plasma
è la saldatura a punti per fusione di lamiere sottili o di sottili rivestimenti su
lamiere spesse.
L'energia concentrata del getto di plasma limita, in tale applicazione, le distorsioni delle lamiere sottili.
In certi casi i punti di saldatura per
fusione possono essere parzialmente
sovrapposti in modo da formare dei
giunti a tenuta.
4.4 Saldatura Plasma MIG
Una variante dell’apparecchiatura di
arco trasferito è quella in cui al plasma è associato un metallo d'apporto:
si parla in tal caso di plasma MIG, nel
quale un arco (arco MIG) scocca fra
filo elettrodo e pezzo ed è attorniato da
un flusso di plasma trasferito, creato da
un secondo elettrodo infusibile (Figg.
14 e 15). Ciò permette di aumentare la stabilità e le modalità di trasferimento delle gocce senza spruzzi ed
oscillazioni; inoltre, per fili di diametro maggiore di 1 mm, permette di aumentare la produttività ed il deposito
di materiale d'apporto e di accrescere
Spessore
[mm]
Corrente
[A]
Tensione
[V]
Velocità
[cm/min]
Diametro
ugello
[mm]
Portata
gas
plasma
[l/min]
Portata
gas
protettivo
[l/min]
3.2
185
21
51
2.8
3.7
30
4.75
175
25
33
3.5
8.4
30
10
225
38
25.5
3.5
15
30
12.7
270
36
25.5
3.5
12.6
30
15.3
250
39
182.8
3.5
14
30
Figura 15 - Plasma MIG
Figura 14 - Schema del processo plasma MIG
la penetrazione; la torcia diviene per
contro molto più complessa e pesante
di quella MIG per cui poco adatta a
procedimenti semiautomatici. Per tale
motivo la diffusione del Plasma MIG
è piuttosto limitata ed è stata usata nel
passato soprattutto per saldatura e per
riporti in piano, ora soppiantati da altri
procedimenti.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012 689689
Corso di QualiÀcazione a International Welding Technologist (IWT),
International Welding Engineer (IWE)
Genova 2013
L’IIS terrà presso la propria Sede di Genova, nel 2013, il proprio tradizionale Corso di
QualiÀcazione per International Welding Engineer / Technologist, con struttura modulare, condensando le lezioni nell’arco di una settimana al mese. La formula ha riscosso nel tempo
il gradimento del pubblico, poiché consente di limitare l’impegno mensile garantendo, al tempo
stesso, condizioni ideali all’apprendimento. Tra gli elementi caratterizzanti la proposta formativa
di IIS è da segnalarsi la completezza del materiale didattico che comprende la collana completa
delle dispense, interamente a colori, la raccolta completa di oltre 300 norme europee relative
alla saldatura (ed alle materie ad essa correlate) in un CD appositamente creato in collaborazione con l’UNI e il calibro IIS di tipo “Bridge cam”, utile strumento di lavoro per lo svolgimento
dell’attività del Coordinatore di saldatura.
Requisiti di ingresso
3HUFKLGHVLGHULDFFHGHUHDOODTXDOLÀFD]LRQHDG
‡ International / European Welding Technologist, è previsto il possesso di un diploma
di scuola superiore ad indirizzo tecnico (o equivalente), della durata di 5 anni;
‡ International / European Welding Engineer, laurea o diploma universitario in IngegneULDLQDOWHUQDWLYDODXUHDLQDOWUHIDFROWjVFLHQWLÀFKHDEELQDWDDGXQDFRPSURYDWDHVSHULHQ]D
di saldatura.
Sono ammessi alle lezioni, in qualità di uditori, anche persone non in possesso dei titoli suddetti.
Calendario delle lezioni e sede di svolgimento
Il Corso prevede quattro materie di tipo teorico (svolte nelle Parti 1 e 3) ed una fase dedicata
all’addestramento pratico (Parte 2). Le lezioni saranno svolte a tempo pieno durante una settiPDQDSHUFLDVFXQRGHLPHVLULSRUWDWLGLVHJXLWR
‡ Parte 1 e 2 (Corso di Specializzazione in saldatura):
Gennaio, Febbraio, Marzo e Aprile 2013
‡ Parte 3 (Moduli Avanzati):
0RGXOR$YDQ]DWR´7HFQRORJLDGHOOD6DOGDWXUDµ0DJJLR
0RGXOR$YDQ]DWR´0HWDOOXUJLDH6DOGDELOLWjµ*LXJQR
0RGXOR$YDQ]DWR´3URJHWWD]LRQHHFDOFRORµ6HWWHPEUH
0RGXOR$YDQ]DWR´)DEEULFD]LRQHDVSHWWLDSSOLFDWLYLµ2WWREUHH1RYHPEUH
I Moduli integrativi per i soli Welding Engineer saranno tenuti nei mesi di Luglio 2013
(Metallurgia,Tecnologia della Saldatura) e Dicembre 2013 (Progettazione e Calcolo, Fabbricazione).
Orario delle lezioni
Per offrire un’alternativa alla tradizionale articolazione delle lezioni a coloro che preferiscano
concentrare l’impegno in settimane non consecutive, a tempo pieno, il Corso sarà svolto con
RUDULR¸DGHFFH]LRQHGHOOHJLRUQDWHGLOXQHGuRUDULR¸HGLYHQHUGu
RUDULR¸SHUFRQVHQWLUHDJOLDOOLHYLGLUDJJLXQJHUHODVHGHGHO&RUVRVHQ]DVSRVWDmenti festivi.
Iscrizioni
Le iscrizioni dovranno pervenire entro lunedì 14 Gennaio 2013.
Dato il limitato numero di posti, costituirà criterio preferenziale la data di iscrizione.
Il modulo d’iscrizione può essere richiesto direttamente alla Divisione Formazione dell’IIS oppure
scaricandolo dal sito www.formazionesaldatura.it.
Quote di iscrizione
La quota di partecipazione al Corso, comprensiva del pranzo presso la mensa dell’IIS e della
FROODQDFRPSOHWDGHOOHSXEEOLFD]LRQLqSDULD
‡ 6.900,00 €, per Welding Technologist;
‡ ½SHU:HOGLQJ(QJLQHHU
GDFRUULVSRQGHUVLPHGLDQWHERQLÀFREDQFDULRVXOFRQWRFRUUHQWH%DQFDGL/HJQDQR*UXSSR
%DQFD 3RSRODUH 0LODQR ,%$1 ,7: LQWHVWDWR DOO·,VWLWXWR ,WDOLDQR
della Saldatura. Si segnala che questi corsi sono svolti in regime di esenzione IVA (Rif. punto
20, Art. 10 del DPR 633/1972).
Informazioni
Per ulteriori informazioni è possibile rivolgersi all’Istituto Italiano della Saldatura
9LD/XQJRELVDJQR,VWULD*HQRYD'LYLVLRQH)RUPD]LRQH
7HO)D[ZZZIRUPD]LRQHVDOGDWXUDLWIRUPD]LRQH#LLVLW
!! !"#"
•
•
•
•
•
!"#$ %&'&$&'$!
()*++,+--./"0"
1/2-++2-+2-/-,3
444
444
La più ampia gamma di soluzioni
per la saldatura e taglio
Il Gruppo AIR LIQUIDE Welding è uno dei leader nel mercato della saldatura e taglio dei metalli.
Attraverso diversi marchi di fama internazionale SAF-FRO, OERLIKON, CEMONT, WELDLINE propone un’ampia gamma
di impianti di saldatura e taglio, prodotti di consumo, accessori e servizi associati alle imprese che lavorano il metallo.
Con il C.T.A.S. (Centro Tecnico di Applicazioni della Saldatura), il più importante centro privato al mondo di ricerca e sviluppo
nel settore della saldatura, AIR LIQUIDE Welding offre costantemente ai suoi clienti soluzioni innovative per migliorare le loro
performance e la loro produttività, mantenendo come principale obiettivo il comfort e la sicurezza degli operatori.
FRO-AIR LIQUIDE Welding Italia
www.airliquidewelding.it
[email protected]
Scienza e Tecnica
Scienza
e
Tecnica
Idrogeno e metalli
Già nei primi anni del XX secolo si è
cominciato a interpretare alcuni cedimenti di materiali metallici pensando
ad una possibile interazione con la
presenza dell’idrogeno nel metallo
stesso. Di fatto, l’effetto dell’idrogeno
nei metalli ha sempre suscitato notevole interesse per le sue particolari capacità di intervenire nel loro comportamento meccanico e per le sue uniche
proprietà chimico-fisiche e di interazione con i reticoli cristallini e relativi
difetti; ciò è quanto mai attuale considerando le applicazioni dell’idrogeno
come combustibile attualmente in fase
di rapido studio e sviluppo.
Ad oggi è noto che l’idrogeno possegga una grande abilità nel diminuire
l’affidabilità in servizio di componenti
realizzati in acciaio ed in altre leghe
(p.e. a base nichel o titanio), ma forse
non è parimenti noto come l’effetto di
tale elemento (il primo e più piccolo
nella Tavola periodica di Mendeleev)
non abbia una sola possibilità di manifestarsi; anzi, i danneggiamenti indotti dall’idrogeno nelle leghe metalliche sono di diversa tipologia e fenomenologia:
r
r
r
r
r
blistering da idrogeno;
fisheye / fiocchi;
attacco da idrogeno a caldo;
formazione di idruri;
infragilimento da idrogeno.
Ad eccezione dell’infragilimento da
idrogeno che coinvolge l’idrogeno in
forma atomica, negli altri danneggiamenti introdotti è sempre coinvolta
una trasformazione di fase.
L’idrogeno è in grado di diffondere
all’interno dei metalli come atomo o
come ione meglio che come molecola
(H2); pertanto, l’assorbimento di idrogeno è strettamente correlato alla presenza di idrogeno atomico (nascente)
sulla superficie del metallo.
La presenza di idrogeno nascente a
sua volta presuppone la dissociazione/presenza dell’idrogeno molecolare
dell’ambiente che deve essere adsorbito a livello superficiale. Condizioni di
alta temperatura, alte pressioni e processi elettrochimici (p.e. corrosione, in
particolare in ambiente acido dominato dalla reazione catodica di riduzione
dell’H+) possono favorire l’adsorbimento superficiale e la penetrazione
dell’idrogeno nascente nei reticoli cristallini. Pertanto, la concentrazione di
idrogeno all’interno dei metalli è proporzionale alla sua fugacità (concentrazione) in superficie (Fig. 1).
A questo punto il cammino dell’idrogeno può scegliere diverse strade
preferenziali all’interno della microstruttura cristallina: o fermarsi in siti
interstiziali presenti all’interno dei
reticoli o rimanere intrappolato in siti
“particolari” associati tipicamente a
vari difetti cristallini.
Negli acciai l’idrogeno atomico presente nei siti interstiziali tende a
espandere/deformare questi ultimi in
virtù delle sue dimensioni che sono
maggiori dei siti stessi; quindi, se può,
l’idrogeno preferisce fermarsi nei siti
“particolari” laddove risulta essere
meglio accomodato; alcuni esempi di
siti particolari possono essere bordi
grano, dislocazioni, vacanze, vuoti,
inclusioni, seconde fasi. Ad esempio,
la presenza di incrudimento in un
metallo favorisce l’assorbimento di
idrogeno attraverso un incremento di
dislocazioni e vacanze. Di norma il
rapporto tra la concentrazione dell’idrogeno nei siti particolari e quella
dei siti interstiziali è maggiore per i
reticoli cubici a corpo centrato (ferrite) e tetragonali (martensite) rispetto
ai reticoli cubici a facce centrate (austenite). L’idrogeno presente nei siti
straordinari è sovente definito idrogeno intrappolato, mentre l’idrogeno
nei siti interstiziali è definito idrogeno
disciolto o “diffusibile”.
E’ noto come nelle leghe a base ferro
di tipo CCC (acciai ferritici) la solubilità generale dell’idrogeno è minore e
la diffusività (tunneling) è maggiore rispetto alle leghe con reticolo cubico a
facce centrate (CFC), quali acciai inossidabili austenitici. La struttura fuori
equilibrio martensitica degli acciai è
caratterizzata da notevole distorsione
del reticolo e densità di dislocazioni,
quindi presenta una maggiore solubilità e minore diffusività dell’idrogeno
rispetto alla ferrite.
Blistering da idrogeno
I fenomeni di blistering si realizzano in presenza di una certa quantità
di idrogeno assorbito nel metallo, in
particolare per effetto dell’idrogeno
accumulato nei siti straordinari quali
ad esempio superficie di interfaccia
tra inclusioni e matrice metallica e in
presenza di difetti di laminazione. Una
volta accumulato, l’idrogeno nascente
si ricombina a idrogeno molecolare
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
693
Scienza e Tecnica
inducendo una locale alta pressione
all’interfaccia. L’entità di tale pressione è funzione, come ovvio, della quantità di idrogeno assorbito nel metallo,
ma altresì del rapporto tra idrogeno
intrappolato ed idrogeno diffusibile,
nonché della temperatura.
Se l’idrogeno proviene da ambienti di
esercizio gassosi ad alta pressione, la
pressione all’interfaccia inclusione/
matrice non supera la pressione del
gas stesso; al contrario, elevate pressioni locali possono verificarsi nel
caso di idrogeno assorbito per via elettrochimica, essendo la concentrazione
di idrogeno nascente sulla superficie, e
quindi di conseguenza quella interna,
anche di qualche ordine di grandezza
superiore rispetto al caso precedente.
In presenza di elevate concentrazioni
di idrogeno molecolare all’interfaccia
matrice/inclusione (elevata concentrazione di idrogeno nel metallo e presenza di numerosi siti di accumulo), la
pressione può raggiungere valori tali
da deformare plasticamente il materiale formando un blister.
Se il materiale non possiede un’adeguata duttilità, l’accumulo di idrogeno all’interfaccia induce una serie di
cricche piuttosto che un rigonfiamento
(Hydrogen Induced Cracking).
Fisheye / fiocchi
In certe situazioni, l’assorbimento di
idrogeno e la successiva precipitazione interna, in manufatti metallici
ottenuti per fusione, può indurre la
formazione di cricche interne di tipo
fragile. La fonte tipica di idrogeno in
questi casi è la presenza di umidità a
contatto con il metallo fuso.
La solubilità dell’idrogeno diminuisce
con il passaggio solido liquido e l’eccesso di quest’ultimo precipita in corrispondenza di micro vuoti, inclusioni
o altre imperfezioni; in tale situazione
la pressione intorno alla zona di precipitazione dell’idrogeno aumenta; in
presenza di idrogeno nel reticolo cristallino, gli apici dell’imperfezione
non si plasticizzano (perdita di tenacità) e quest’ultima di propaga, se sollecitata da una tensione di trazione, in
maniera fragile e intergranulare fino
a scaricare la stessa pressione interna. Tali danneggiamenti compaiono
tipicamente allorquando un materiale
venga fratturato per sovraccarico in
tensione (p.e. prova di trazione monoassiale); all’interno della tipica superficie di frattura per sovraccarico si
possono distinguere alcune caratteristiche superfici brillanti riconducibili
alle fessurazioni interne indotte dall’idrogeno (fisheye).
Se tali difetti interni indotti dall’accumulo di idrogeno nel metallo intorno
a micropori/inclusioni con una prima
propagazione fragile della cricca, si
formano per effetto di deformazioni di
forgiatura, il danneggiamento specifico prende il nome di fiocchi.
Quindi, nel caso di fisheye il difetto si
rende evidente in fase di sovraccarico
in tensione (p.e. prova di trazione), nel
Figura 1 - Fenomeno di assorbimento di idrogeno in un metallo
694
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
caso di fiocchi in fase di lavorazione
(forgiatura).
Attacco da idrogeno
L’attacco da idrogeno è tipicamente
indotto dalla formazione di una fase
gas, generalmente insolubile, per reazione dell’idrogeno assorbito con elementi di lega o impurità all’interno di
un metallo. Due esempi sono la reazione dell’idrogeno con inclusioni di ossido di rame nelle leghe di rame con formazione di vapore acqueo (problema
non più diffuso grazie all’utilizzo di
rame disossidato) e la reazione dell’idrogeno con i carburi negli acciai con
formazione di metano. Tali processi
avvengono per alte temperature e alte
pressioni parziali di idrogeno.
In particolare negli acciai ferritici
l’assorbimento di idrogeno e la sua
mobilità interna portano ad un accumulo dello stesso in corrispondenza di
interfacce microstrutturali (p.e. bordi
grano, interfaccia ferite/perlite), soprattutto se presenti micro pori indotti
da inclusioni o difetti.
L’idrogeno atomico si ricombina ad
idrogeno molecolare e reagisce con i
carburi (p.e. carburo di ferro-cementite) formando metano (CH4); la formazione di metano è termodinamicamente favorita per temperature superiori a 200 °C. Il valore di pressione
di equilibrio del metano, accumulato
in corrispondenza delle interfacce,
può diventare tale da favorire la formazione e propagazione di microcricche; in aggiunta, se sono presenti tensioni agenti sul materiale (applicate
o residue), queste agiscono in sinergia con la pressione all’interfaccia e
le microcricche possono innescarsi
e propagarsi per valori di pressione
di equilibrio di metano più modesti.
Successivamente, le microcricche si
possono collegare per formare delle
macro-fessurazioni ad andamento intergranulare. In presenza di elementi
carburigeni (p.e. Cr, Mo, V, Ti, Nb) la
maggiore stabilità dei carburi conduce a minori pressioni di equilibrio di
metano e, pertanto, a minori probabilità di formazione di microcricche; per
tale motivo gli acciai ferritici del tipo
Scienza e Tecnica
Figura 2 - Diffusione dell’H verso l’apice di una cricca e meccanismi di infragilimento
Cr-Mo (V) sono di norma utilizzati per
garantire maggiore affidabilità in servizi idrogeno a caldo, in particolare
nell’industria petrolifera.
Formazione di idruri
Alcuni metalli, in presenza di idrogeno assorbito in quantità superiore ad
una specifica concentrazione critica,
tendono termodinamicamente a formare idruri. La precipitazione di idruri come fasi metallo-idrogeno avviene
quando la concentrazione di idrogeno
supera il limite di solubilità dello stesso. Materiali tipicamente soggetti alla
formazione di idruri sono il titanio,
lo zirconio, il tantalio. Gli idruri metallici sono composti a bassa densità
tipicamente fragili che diminuiscono
la duttilità e la tenacità delle leghe.
L’influenza degli idruri sulle caratteristiche meccaniche del metalli dipende
dalla quantità, dalla distribuzione e
dall’orientamento preferenziale degli
idruri nella matrice cristallina.
Infragilimento da idrogeno
I danneggiamenti introdotti fino ad
adesso presupponevano uno step specifico con cambiamento di fase (p.e.
precipitazione di idrogeno molecolare, formazione di una fase insolubile
gassosa, formazione di idruri); al contrario, l’infragilimento da idrogeno è
correlato ad un effetto sulle caratteristiche meccaniche di alcuni materiali
indotto da una specifica quantità di
idrogeno disciolto in forma atomica.
L’effetto dell’infragilimento causato
dall’idrogeno può manifestarsi anche
per tensioni inferiori al carico di snervamento e può essere dilazionato nel
tempo (cricche ritardate).
Qualitativamente il processo dell’infragilimento da idrogeno può essere
schematizzato come segue:
r L’idrogeno è assorbito nel metallo durante la fabbricazione o il
servizio.
r L’atomo di idrogeno si distribuisce nei siti interstiziali e, più favorevolmente, nei siti particolari,
dove trova più spazio.
r I siti particolari sono distribuiti
in maniera casuale nella matrice
e, parimenti, l’idrogeno si distribuisce macroscopicamente in maniera casuale nel materiale, perlomeno finché il componente non
è posto in servizio.
r I carichi di esercizio, siano essi
applicati o residui (si pensi alle
saldature), producono locali aree
di distorsione del reticolo, in particolare all’apice di intagli o difetti; l’idrogeno migra favorevolmente verso queste zone caratterizzate da distorsione del reticolo
laddove può raggiungere una certa concentrazione critica per nucleare una cricca che si propaga
a sua volta attraverso la regione
a più alta concentrazione di idrogeno; il tempo necessario per formare una cricca dipende da fattori quali lo stato metallurgico del
materiale (intrinseca fragilità), la
temperatura, il contenuto di idrogeno e l’entità delle tensioni.
r La nucleazione e propagazione
r
della cricca ridistribuisce localmente le tensioni e sposta la regione caratterizzata da dilatazione del reticolo appena al di sotto
del nuovo apice.
L’idrogeno diffonde verso la
nuova regione a reticolo distorto
(nuovo apice) provocando una
successiva propagazione.
Per quanto sopra esposto, si evince
chiaramente come l’effetto dell’infragilimento da idrogeno, essendo correlato anche a fenomeni di diffusione,
sia funzione della velocità di deformazione (strain rate) del componente e,
in fenomeni di fatica, alla frequenza di
applicazione del carico.
I meccanismi per cui la presenza di
idrogeno nel reticolo favorisce la propagazione di una fessura sono correlati a fenomeni quali HEDE (Hydrogen
Enhanced DEcohesion) che prevedono
una diminuzione della resistenza delle
interfacce microscopiche in presenza
di idrogeno (bordi grano, interfase) e
HELP (Hydrogen Enanched Localized
Plasticity) che, altresì, sono associati ad una maggiore plasticizzazione
all’apice della cricca per una più facilitata emissione di dislocazioni, ancora una volta favorita dall’idrogeno nel
reticolo (Fig. 2); infatti, alcune dettagliate osservazioni frattografiche hanno evidenziato locali plasticizzazioni
in rotture indotte da infragilimento da
idrogeno.
Ing. Marco De Marco
Divisione Laboratorio IIS
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
695
IIS News & Events
News & Events
Giornate Nazionali di Saldatura 7:
lavori in corso
Può sembrare paradossale, ma in
Istituto abbiamo iniziato a pensare
alla settima edizione delle Giornate
Nazionali di Saldatura quando la sesta
ancora si doveva concludere, al culmine di uno sforzo organizzativo che
consentiva peraltro di mettere in luce
gli spazi di miglioramento certamente
esistenti, sfruttando le sensazioni ed
i pareri espressi in modo più o meno
ufficiale da visitatori, sponsor, relatori
e colleghi.
Dopo una fase di incubazione, se così
vogliamo dire, necessaria a metabolizzare questi contribuiti, lo staff responsabile delle Giornate ha ripreso
ad operare nel secondo semestre dello
scorso anno, con la prospettiva di arrivare dopo alcuni mesi e per approssimazioni successive al primo programma preliminare, che è stato già
distribuito anche ai lettori di codesta
Rivista in occasione della pubblicazione del numero 4/2012.
Nel prosieguo di questa rubrica cerchiamo dunque di illustrare alle nostre lettrici ed ai nostri lettori le caratteristiche principali della prossima
edizione delle Giornate, evidenziando
le differenze più significative rispetto
all’evento svoltosi nello scorso 2011.
Sede della manifestazione, ancora
una volta, saranno gli spazi presso i
Magazzini del Cotone del Porto Antico di Genova, ormai ben noti a tutti i
frequentatori delle Giornate: nel passato, come molti ricordano, le Giornate si sono svolte a Milano come a
mento. Più nel dettaglio, abbiamo pensato a qualche variazione, per una migliore gestione degli spostamenti delle
persone e per garantire la presenza
costante della reception nell’arco della durata dell’intera manifestazione.
Venezia, ma è parere condiviso da numerosi addetti ai lavori che questa sia
la Sede migliore tra quelle proposte,
considerando la facilità con cui risulta
raggiungibile e la distribuzione degli
spazi disponibili, che si prestano con
estrema flessibilità ai singoli eventi
programmati (la cerimonia inaugurale, i singoli Workshop, le colazioni di
lavoro, principalmente).
Eventuali apprezzamenti sulla bellezza
della Sede preferiamo lasciarli ai partecipanti, poiché il nostro parere risulterebbe doppiamente di parte, come
organizzatori e come genovesi: anche
in questo caso, tuttavia, molti ci hanno
comunque espresso il loro apprezza-
La struttura delle Giornate è invariata
nelle sue linee fondamentali, che risultano ormai collaudate dalle varie
edizioni svolte: il primo momento si
svolgerà quindi nello scenario della
Sala Maestrale, a partire dalle ore 10
di Giovedì 23 Maggio, con il benvenuto ai partecipanti porto esclusivamente dalle principali cariche del Gruppo
IIS e dal tradizionale ospite Internazionale, in rappresentanza degli organi direttivi della European Welding Federation (EWF), per rendere più fluida
questa prima parte.
Nella successiva Convention dell’IIS
Club, un vero e proprio momento di
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
697
IIS News & Events
aggiornamento e di ritrovo per la
grande comunità delle Figure Professionali (coordinatori di saldatura,
ispettori di saldatura, addetti alle prove non distruttive, in particolare) saranno illustrati risultati di un’attività
che IIS sta lanciando proprio in questi
giorni, coinvolgendo il maggior numero possibile di Aziende manifatturiere
che operano in Italia nella realizzazione di prodotti saldati, con l’ambizioso
obiettivo di arrivare ad un vero e proprio Libro Bianco della Saldatura Italiana. Nella sostanza, anche per colmare una forte lacuna esistente ormai
da anni rispetto ad altre importanti
nazioni (europee e non), IIS si propone di raccogliere una serie di dati da
parte delle Aziende suddette per offrire loro, nella sintesi finale, un ritratto
il più possibile preciso e significativo
sui principali aspetti che riguardano
appunto la saldatura: tecnologie in
uso, presenza di personale qualificato,
grado di automazione degli impianti,
scenari normativi, per svelare solo
alcuni degli argomenti per cui chiederemo la testimonianza alle Aziende.
In analogia a simili iniziative svolte
in Italia, in altri ambiti, come anche
all’estero, nella costruzione saldata,
ci auguriamo in tal modo di rendere
disponibili agli interessati dati preziosi per i cosiddetti addetti ai lavori,
favorendo il confronto con altre realtà
internazionali e dando magari spunti
interessanti con cui valutare indirizzi
ed eventuali investimenti, in uno scenario notoriamente complesso ed incerto.
Proseguendo la nostra presentazione in ordine temporale, troviamo nel
programma preliminare il momento
698
della premiazione di persone fisiche ed
Aziende, grazie al quale – tra l’altro –
è stato possibile nella scorsa edizione
valorizzare realtà interessanti, grazie
ad esempio alla riuscita manifestazione denominata Olimpiadi Nazionali
di Saldatura, i cui vincitori della II
edizione saranno appunto premiati in
questa occasione; sarà prevista dalla
II edizione anche una categoria Giovani, limitata a partecipanti che non
abbiano superato una data età, i cui
vincitori potranno rappresentare l’Italia nell’analoga manifestazione a
livello europeo.
In parallelo, sarà aperto lo spazio
espositivo, come nelle ultime edizioni,
ulteriormente ampliato e razionalizzato: per quanto le GNS non siano assimilabili ad una fiera, essendo una manifestazione di natura tecnico – scientifica, questi spazi hanno una valenza
notevole nel favorire il rapporto tra
visitatori e società espositrici e sponsor, che alle Giornate ormai sono soliti
portare novità significative, considerandole l’evento principale del settore.
A tal proposito, segnaliamo con piacere che a poco meno di otto mesi dalla
manifestazione molte società leader
del mondo delle costruzioni saldate
hanno già aderito quali sponsor e precisamente:
Esab Saldatura Spa (Bareggio MI),
Commersald Group Spa (Cognento
MO), Trafilerie di Cittadella Spa (Cittadella PD), Orbitalum Tool GmbH
(Germania), Rivoira Spa (Torino),
Gilardoni Spa (Mandello Lario LC),
Nardoni Institute Srl (Brescia), Lincoln
Electric Italia Srl (Serra Riccò GE),
Welding Alloys Srl (Peschiera Borro-
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
meo MI), Lansec Italia Srl (Cinisello
Balsamo MI), Itw Welding Products
Italia (San Giuliano Milanese MI),
Tecnolettra Spa (Calco LC), Siad Spa
(Bergamo), Lorch Schweisstechnik
GmbH (Germania), Aec Technology
Srl (Campagnola Cremasca CR), Linde
Gas Srl (Arluno MI), Böhler Welding
Group Italia Spa (Milano), Olympus
Italia Srl (Milano), Outokumpu Spa
(Genova), Fro-Air Liquide Welding
Italia Spa (Verona), Messe Essen
GmbH / Fiera di Essen (Germania),
Smart Ndt Srl (Vimercate MB), Ndt
Italiana Srl (Concorezzo MI), Sandvik
Spa (Milano), Ine Spa (Padova), Semat
Italia Spa (Arcore MI) e Phoenix Srl
(Ivrea TO).
Tornando al programma, ed esauriti
gli eventi allocati nella prima mattinata, si passerà al buffet inaugurale,
momento certamente di relax per gli
amanti della buona cucina ma anche
di relazione e di contatto, per chi vo-
IIS News & Events
i quali costituiranno due veri e propri
eventi nell’evento, cui sarà possibile
partecipare anche singolarmente, data
la specificità degli argomenti trattati,
caratteristici di settori industriali che
hanno solo limitate sovrapposizioni
con quelli interessati al resto del programma. Questi eventi si svolgeranno
nell’ambito dell’intera giornata, secondo l’attuale programma.
glia sfruttare sino in fondo il tempo
disponibile.
Nel primo pomeriggio di Giovedì 23
Maggio avranno inizio gli eventi prettamente tecnici, il cui impianto è noto
e collaudato dalle numerose edizioni
svolte. IIS tiene particolarmente alla
qualità delle presentazioni, cui ha
posto un’attenzione ancora maggiore, abbinando al tradizionale “call
for papers” (con cui è possibile ottenere contributi magari da realtà ed
autori nuovi) ad un certo numero di
presentazioni ad invito, rivolte ad interlocutori di comprovata valenza e
statura tecnica. In questo pomeriggio
del primo giorno, più in particolare,
sono previsti i Workshop afferenti alle
materie “Affidabilità delle strutture e
degli impianti” (coordinato dall’Ing.
Giancarlo Canale, di IIS Service) e
“Diagnostica e prove non distruttive”
(a sua volta affidato all’Ing. Francesco Peri, anch’egli di IIS Service), con
orario 14:30 – 18:00. Nel programma
preliminare, già distribuito con questa
stessa Rivista e disponibile sui vari
media di IIS, è possibile trovare alcuni
dei temi già selezionati dalla Commissione Tecnica delle Giornate (si osserva, al riguardo, una partecipazione
attiva nel primo Workshop da parte di
alcuni atenei, come Ferrara, Genova e
Messina, così come nel secondo Workshop si conferma l’importanza sempre crescente delle tecniche avanzate
di controllo ultrasonoro, tra le altre
linee di tendenza).
In parallelo ai due primi Workshop
suddetti prenderanno il via i primi
due corsi dei sei previsti, anch’essi
in parallelo, confermando la natura
di contenitore delle Giornate, in cui
ciascuno costruisce la propria partecipazione secondo le proprie preferenze, senza essere tenuto a rispettare un
singolo programma vincolante. I temi
dei corsi, in questa occasione, saranno un mix tra argomenti di consolidato
interesse (aggiornamenti sulla normativa per la qualificazione di processi di
saldatura e saldatori, tecniche avanzate per il controllo non distruttivo dei
giunti) ed altri maggiormente legati a
sviluppi recenti nel campo della tecnologia, della saldabilità o della fabbricazione (processi ibridi di saldatura, acciai austeno – ferritici di ultima
generazione, controllo delle tolleranze
di prodotti saldati, requisiti per la progettazione di grandi strutture soggette
ad azioni sismiche).
Si avvierà alla conclusione questa
prima giornata, i cui protagonisti e
partecipanti saranno infine invitati ad
un aperitivo accompagnato da musica
live, che rappresenta una delle novità
della prossima edizione delle Giornate, offrendo un ulteriore momento di
relazione e di relax.
I lavori proseguiranno il successivo
Venerdì 24 Maggio, offrendo ancora ai
partecipanti un’ampia scelta di eventi
in parallelo: oltre ai corsi, cui abbiamo appena fatto cenno, saranno svolti due ulteriori Workshop relativi agli
argomenti “Metallurgia e saldabilità”
(coordinato dall’Ing. Alberto Lauro,
di IIS) e “Qualità e sicurezza nella
fabbricazione mediante saldatura”
(affidato all’Ing. Luca Timossi, di IIS
Cert): se il primo si conferma uno degli eventi più frequentati ed apprezzati,
il secondo si ripropone con contenuti
e temi rinnovati, come i nostri lettori
hanno modo di notare dal Programma
Preliminare.
Parallelamente ai due Workshop
avranno inizio due eventi inediti, con
i quali ci proponiamo di ampliare ulteriormente l’interesse delle Giornate,
dedicati rispettivamente alla “Giunzione dei materiali plastici e compositi” ed alla “Saldatura in elettronica”,
Dopo la colazione di lavoro, al termine della mattinata, si arriverà all’ultimo segmento della manifestazione, il
Venerdì pomeriggio, con tre filiere di
eventi in programma: la prosecuzione
dei nuovi eventi dedicati a materiali
plastici e compositi ed all’elettronica, gli ultimi due corsi e gli ultimi due
Workshop, dedicati ai temi “Fabbricazione di strutture e componenti saldati” (con il coordinamento dell’Ing.
Sergio Scanavino, di IIS Service) e
“Tecnologia della Saldatura” (affidato all’Ing. Michele Murgia, di IIS).
Anche in questo caso, il Programma
preliminare aiuta ad individuare degli
indirizzi, come il crescente impegno
dei costruttori italiani all’estero (Fabbricazione) e l’ascesa dei processi non
ad arco elettrico (Tecnologia).
A differenza dell’edizione precedente,
i lavori si concluderanno alle 17:30,
quindi un poco prima, considerando
l’esigenza di molti di tornare alle rispettive sedi. Anche le GNS7 andranno
a questo punto in archivio: qualcuno,
ne siamo certi, avrà iniziato certamente a pensare all’edizione numero
otto.
Segreteria Organizzativa GNS7
Presidente:
Mauro Scasso
Segretario Generale IIS
Coordinamento manifestazione:
Michele Murgia
Tel. +39 010 83 41 405
[email protected]
Rapporti con la stampa e gli sponsor:
Franco Ricciardi
Tel. +39 010 83 41 389
[email protected]
Segreteria:
Ivana Limardo
Tel. +39 010 83 41 373
[email protected]
Per iscrizioni:
[email protected]
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
699
2
ANNI DI SUCCESSI
Gentile lettore,
abbiamo deciso di celebrare i primi 20 anni di presenza del marchio Lansec in Italia con il
Catalogo Generale Sicurezza riunendo le linee di prodotto storiche della protezione in saldatura
con le nuove della linea antinfortunistica allargando l’offerta alle aziende specializzate del
settore. Nel 1992 abbiamo iniziato il nostro lavoro con una strategia commerciale chiara,
all’interno di un progetto italiano che guardava all’evoluzione europea; l’obbiettivo aziendale
comune era fondato sulla competenza e sull’innovazione, sull’informazione costante nelle
aziende circa le soluzioni all’avanguardia che potessero migliorare l’attività dei lavoratori con a
reciproca soddisfazione di maestranze e imprenditori. A distanza di 20 anni siamo certi di aver
contribuito a diffondere il significato di sicurezza negli ambienti di lavoro; ed essere orgogliosi di
aver lasciato in mano ai lavoratori gli strumenti di qualità necessari all’ottimizzazione del loro
lavoro.
La prevenzione degli infortuni è un investimento per l’azienda, non un costo!
Scarica i 20 anni di successi su: www.lansec.it
LANSEC ITALIA Srl - Via Bizet 36/N Cinisello Balsamo - MI
Tel. 02 99785118 - www.lansec.it
LA PROTEZIONE DEL SALDATORE
Abbiamo provato per voi...
Abbiamo provato
per voi...
Liquidi Penetranti
Elite Flaw-Findr
di NDT ITALIANA
1. Introduzione
Il controllo con liquidi penetranti è
uno dei più diffusi metodi di indagine
non distruttiva, in particolare per la
relativa semplicità di esecuzione e per
il suo ampio campo di applicazione
che va dai materiali metallici ai plastici e vetrosi. Il metodo è ampiamente
utilizzato per individuare imperfezioni
superficiali e consiste nell’applicazione di un liquido (detto appunto penetrante) sulla superficie in esame in
grado di penetrare nelle discontinuità
eventualmente presenti sulla stessa.
Il liquido in eccesso viene successivamente rimosso e la superficie viene cosparsa con un mezzo (detto rilevatore)
in grado di assorbire il penetrante rimasto intrappolato nelle imperfezioni,
amplificando il segnale e rendendolo
visibile. Tale procedimento è però fortemente influenzato da diversi fattori
che possono vincolare la sensibilità
dell’esame, quali:
r le condizioni superficiali del pezzo;
r la temperatura superficiale del
pezzo;
r la risalita capillare;
r le condizioni di visione durante
l’ispezione finale.
Una delle più comuni esigenze riscontrate da chi effettua questo questo tipo
di ispezione, specialmente se le temperature impiegate non sono comprese
nell’intervallo previsto dalle principali norme di riferimento, è quella
di avere un prodotto, riconosciuto a
livello normativo, compatibile sia per
basse sia per alte temperature di prova. In tal modo, si avrebbero minori
problemi di sicurezza per l’operatore e maggior versatilità di controllo,
comunque senza compromettere la
sensibilità d’esame alle diverse temperature. Inoltre, oggi sempre più si
percepisce una maggiore sensibilità ai
problemi dell’ambiente che si traduce
nel tentativo di ridurre il consumo di
sostanze inquinanti quali derivati del
petrolio e gas nocivi per l’ambiente.
La correlazione tra controllo con liquidi penetranti e impatto ambientale è un problema molto sentito, dato
che i prodotti in gioco, utilizzati nella maggior parte delle applicazioni,
sono costituiti da sostanze chimiche
potenzialmente nocive, nelle quali i
derivati del petrolio sono presenti in
percentuali molto elevate. Inoltre, alcuni prodotti, vengono addittivati con
agenti emulsificanti per rendere il li-
quido penetrante lavabile con acqua.
NDT ITALIANA è una realtà industriale conosciuta nel campo dei controlli
non distruttivi che, da oltre 60 anni
crea, nel rispetto dell’ambiente, prodotti per tutte le principali tecniche
di controllo, tra cui appunto i liquidi penetranti. La famiglia di prodotti
“Elite Flaw-Findr” nasce infatti nel
rispetto degli standards nazionali ed
internazionali (UNI, EN, ISO, AMS,
ASME e ASTM). Come è consuetudine
per la realizzazione di questa Rubrica,
i tecnici dell’Istituto Italiano della Saldatura hanno svolto prove per testare
le caratteristiche di prodotti messi a
disposizione dall’azienda produttrice
degli stessi. In questo numero NDT
ITALIANA ha sottoposto a prova i seguenti consumabili:
r Liquido penetrante a contrasto di
colore K71B2p, a base idrocarburica, qualificato secondo il produttore da 0 °C a 100 °C e rimovibile con acqua, solvente e post
emulsionabile;
r Liquido penetrante a contrasto di
colore K71B2.BIO, a base acqua
ed esente da derivati del petrolio;
r Liquido penetrante a contrasto di
colore K71HT, per alte temperature e rimovibile con solvente;
(*) Redazione a cura della Divisione Formazione IIS, Settore PND, Pasquale Miniello.
Prove condotte in collaborazione con il Laboratorio IIS.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
701
Abbiamo provato per voi...
r
r
r
r
r
Sviluppatore umido in sospensione
di solvente organico D112A;
Sviluppatore umido in sospensione di solvente organico per alte
temperature D200;
Sviluppatore umido in sospensione acquosa DWS2;
Remover non alogenato BC1;
Remover per alte temperature,
RHT.
2. Schede tecniche dei prodotti
La prima verifica effettuata sui prodotti coinvolti nel processo ispettivo
in oggetto è stata la valutazione delle
schede tecniche. Come previsto dalla
normativa, ogni prodotto deve essere corredato da schede tecniche e da
schede di sicurezza esaurienti e comprensibili anche all’operatore meno
qualificato. Le schede tecniche dei
consumabili, fornite in lingua italiana
e inglese, sono di facile comprensione e offrono una descrizione puntuale
delle caratteristiche del prodotto, delle
condizioni d’impiego e delle tecniche
di utilizzo.
Possono essere richieste direttamente al produttore alcune informazioni
quali, ad esempio, le temperature di
flashpoint o le caratteristiche di viscosità.
3. Schede di sicurezza dei
prodotti
I prodotti chimici e le schede di sicurezza ad essi relative, devono essere
conformi al Regolamento Europeo
1907/2006/CE Articolo 31 (REACH),
concernente la registrazione, la valutazione, l'autorizzazione e la restrizione delle sostanze chimiche (Gazzetta
Ufficiale dell'Unione Europea L 396
del 30 dicembre 2006). Tale regolamento, tra l’altro, impone ai produttori le modalità da seguire per valutare
e documentare i rischi legati alle so-
stanze chimiche che fabbricano e per
fare in modo che gli operatori siano in
grado di controllarne adeguatamente i rischi. Negli allegati si definiscono inoltre le prescrizioni relative alla
scheda di sicurezza che costituisce uno
strumento importante per trasmettere
le informazioni di sicurezza appropriate all'utilizzatore finale.
Le schede di sicurezza dei prodotti
della gamma Elite, qui testati, sono
conformi al regolamento europeo e,
soprattutto, chiaramente comprensibili in tutti i 16 punti richiesti dalla
normativa. Tali schede vengono direttamente fornite da NDT ITALIANA
all’utilizzatore all’atto della richiesta
di fornitura e dell’acquisto. Inoltre,
tramite il sito internet dell’azienda, è
possibile richiedere informazioni supplementari relative agli aspetti tecnici
e alla sicurezza.
4. Confezionamento
I consumabili sono disponibili in differenti formati: bombolette spray, taniche e fusti. Questo aspetto rende il prodotto estremamente versatile nell’applicazione, che può essere effettuata
in laboratorio, con impianto fisso, o in
cantiere mediante tecnica spray o pennello. Dal punto di vista pratico, un
altro aspetto positivo si nota sollevando la tanica di sviluppatore D112A da
10 litri. Infatti, il deposito di particelle
ritorna subito in sospensione non appena venga leggermente agitato (come
viene richiesto, ad esempio, dalle normative AMS 2644 E e UNI EN ISO
3452-2); questa caratteristica rende
efficace anche l’utilizzo tramite bomboletta spray e pistola. Sempre veloce
(ma un po’ meno spinta) è la ridispersione delle particelle nel solvente dello
sviluppatore acquoso Elite DWS2.
5. Etichettatura
Strumento importante per la comunicazione, ai sensi del regolamento
REACH, le etichette devono riportare
diverse informazioni come gli identificatori del prodotto, l'identità del fornitore, i simboli di pericolo e i messaggi
di rischio e di attenzione.
Oltre a queste informazioni, le confezioni dei prodotti Elite riportano il
numero di lotto, la data di produzione e la data di scadenza. Quest’ultimo
702
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
aspetto non è secondario dal punto di
vista economico e pratico: la durata
dei prodotti spray è di tre anni (almeno un anno in più rispetto alla maggioranza dei casi riscontrati) mentre per
i prodotti in tanica o in fusto è di 5.
Potrebbe essere inserita nell’etichetta,
per completezza d’informazione, un
riferimento che identifichi il tipo e la
modalità di asportazione dell’eccesso
di penetrante durante le fasi di rimozione dalla superficie.
6. Prove di sensibilità
Per eseguire tutte le prove di sensibilità i tecnici IIS hanno utilizzato:
r blocchi di riferimento di tipo 1, di
spessore 30 μm e 50 μm, secondo
UNI EN ISO 3452-3 “Prove non
distruttive - Esame con liquidi penetranti - Blocchi di riferimento
per le prove”;
r blocco campione di alluminio secondo ASME V articolo 6 (Liquid
penetrant examination) e UNI EN
ISO 3452-5 “Prove non distruttive - Esame con liquidi penetranti
- Parte 5: Prove con penetranti a
temperature maggiori di 50 °C”.
L'affidabilità della prova con liquidi
penetranti è fortemente influenzata
dalla temperatura delle superfici in
esame, la quale è in grado di alterare le caratteristiche fisico-chimiche
dei prodotti; per questo motivo è stata
effettuata una campagna di prove, variando sia la temperatura sia i prodotti
utilizzati, al fine di verificare la rispondenza dei prodotti stessi ai risultati attesi, in termini di sensibilità.
I blocchi di riferimento di tipo 1 sono
pannelli di forma rettangolare costituiti da uno strato uniforme di nichel-cromo - depositato elettrogalvanicamente
- applicato su un supporto di ottone;
su ciascuno di questi pannelli vengono
prodotte artificialmente cricche longitudinali. In funzione dello spessore
dello strato di nichel-cromo esistono
quattro serie di pannelli; per i liquidi a
contrasto di colore si devono utilizzare
esclusivamente i pannelli con deposito
di spessore 30 μm e 50 μm.
Qualora si evidenzino un certo numero
di cricche, la sensibilità si deve verificare su entrambi i pannelli di riferimento. Le prove sono state eseguite
anche su campioni saldati, forgiati e
fusi, contenenti imperfezioni note.
Abbiamo provato per voi...
6.1 Prove a temperatura
standard (10 °C - 50 °C)
Le prove sono state effettuate con temperature superficiali dei blocchi e dei
campioni comprese tra 20 °C e 25 °C.
Per iniziare si è testata la seguente
gamma di consumabili:
r liquido penetrante K71B2p;
r remover BC1;
r sviluppatore D112A.
Si è applicato il liquido penetrante sia
sui pannelli di tipo 1 sia sul blocco
campione ASME (Fig. 1), si è atteso un
tempo di penetrazione di 5 minuti e si
è rimosso l’eccesso di penetrante con
acqua per un minuto. Dopo asciugatura, si è applicato lo sviluppatore in
bomboletta D112A. Trascorsi cinque
minuti di tempo si sono evidenziate
tutte le cricche contenute nei blocchi
di riferimento: tale prova fornisce al
liquido penetrante K71B2p una sensibilità di livello 2 (massima) secondo
UNI EN ISO 3452-2 “Prove non distruttive - Esame con liquidi penetranti
- Parte 2: Prove dei materiali utilizzati
nell'esame con liquidi penetranti”.
In una seconda fase si è testata la seguente gamma:
r liquido penetrante K71B2.BIO;
r remover BC1;
r sviluppatore D112A.
Come nel caso del penetrante a base
idrocarburica K71B2p, riportato in
precedenza, tutte le discontinuità sono
state rilevate, evidenziando una sensibilità di livello 2.
La stessa procedura è stata impiegata
anche per i seguenti prodotti:
r liquido penetrante K71B2.BIO;
r sviluppatore DWS2.
Come nei due casi riportati in precedenza, tutte le cricche presenti nei
pannelli sono state rilevate; ciò dimostra come il liquido in oggetto possa
Figura 1 - Prova di sensibilità eseguita a 22 °C con Elite K71B2p, BC1 e sviluppatore D112A
con blocco di riferimento tipo ASME V articolo 6
raggiungere una sensibilità di livello 2
(UNI EN ISO 3452-2) anche se è qualificato dal produttore con livello 1 (normale). Questo dato è rilevante perché
determina la possibilità di scegliere
un consumabile privo di idrocarburi
e quindi non infiammabile, senza pregiudicare la sensibilità d’esame.
stata definita dal produttore - in accordo alla norma UNI EN ISO 3452-5 e offre all’utilizzatore il vantaggio di
non dover qualificare il procedimento
di controllo ad elevata temperatura,
qualora si conduca il test nelle medesime condizioni di prova prescritte dal
produttore stesso.
6.2 Prove a temperatura
maggiore di 50 °C
La prima prova di sensibilità è stata
effettuata a temperatura di 200 °C impiegando i seguenti prodotti:
r liquido penetrante a contrasto
di colore per alte temperature
K71HT;
r remover RHT1;
r sviluppatore D200.
Esistono vari riferimenti normativi
che permettono di qualificare una procedura di controllo con liquidi penetranti ad alte temperature, tra i quali
ricordiamo:
r UNI EN ISO 3452-5 “Prove non
distruttive - Esame con liquidi penetranti - Parte 5: Prove con penetranti a temperature maggiori
di 50 °C”;
r Codice ASME V articolo 6 (Liquid
penetrant examination).
A tale scopo, la norma ISO consente
di comparare le caratteristiche dei
prodotti in esame dal punto di vista
qualitativo, con l’utilizzo di un blocco di alluminio, criccato mediante un
trattamento termico specifico (come
previsto anche dal Codice ASME V
articolo 6) e dal punto di vista quantitativo, mediante l’utilizzo di blocchi di
riferimento di tipo 1, secondo UNI EN
ISO 3452-3.
Le prove effettuate in quest’analisi
prevedono la comparazione tra un liquido penetrante per alte temperature
e un liquido di sensibilità di livello 2
ad una temperatura compresa tra 10
°C e 50 °C. La procedura utilizzata è
Per l’esecuzione del test è stato necessario riprodurre le condizioni di
utilizzo del prodotto, specifico per alta
temperatura: il campione è stato posto
in forno fino a raggiungere la temperatura superficiale di prova di 200 °C,
(Fig. 2). Una volta ottenuta la temperatura di prova, il campione viene
estratto e sulla superficie viene applicato il penetrante da testare. Successivamente si pone nuovamente in forno
per il tempo di penetrazione indicato
dal fabbricante (1 minuto).
Segue la normale procedura per la
rimozione dell’eccesso di penetrante
con panno leggermente imbevuto di
remover RHT1.
In seguito viene applicato lo sviluppatore D200.
L’ispezione finale ha dato esito positivo: la procedura definita dal produttore ha rilevato tutte le discontinuità
presenti sul pannello.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
703
Abbiamo provato per voi...
Figura 2 - Prova di sensibilità eseguita a 200 °C
con Elite K71HT su blocco di riferimento tipo
1 da 30 μm secondo ISO 3452-3
Gli stessi risultati sono stati ottenuti
su entrambi gli spessori considerati
(30 μm e 50 μm) e con uguale livello
di sensibiltà 2, come indicato dal produttore.
Risultati positivi si sono ottenuti anche
effettuando la stessa prova, a differente temperatura (170 °C), su un giunto
saldato contenente cricche trasversali
in zona fusa.
La seconda prova è stata effettuata a
temperatura di 100 °C impiegando i
seguenti prodotti:
r liquido penetrante a contrasto di
colore K71B2p;
r remover BC1;
r sviluppatore D112A.
La procedura di qualificazione è simile
al caso precedente: ogni prodotto ha
Figura 3 - Prova di sensibilità eseguita a 100 °C
con Elite K71B2p su blocco di riferimento
tipo 1 da 30 μm secondo ISO 3452-3
infatti delle caratteristiche tecniche
differenti, che portano ad avere specifiche modalità di esecuzione della prova, in particolare per quanto riguarda
le temperature e i tempi di ogni singola
operazione.
Il campione è stato posto in forno fino
a raggiungere la temperatura superficiale di prova di 100 °C, (Fig. 3).
Ottenuta la temperatura di prova, il
campione viene estratto e sulla superficie viene applicato con pennello
il penetrante da testare, fatto ciò si
è reintrodotto il pannello all’interno
del forno per il tempo di penetrazione indicato dal fabbricante (3 minuti).
Segue la normale procedura per la
rimozione dell’eccesso di penetrante
con panno inumidito di remover BC1.
Eseguita tale fase si è applicato lo svi-
Figura 4 - Prova di sensibilità eseguita a 100 °C
con Elite K71B2.BIO su blocco di riferimento
tipo 1 da 30 μm secondo ISO 3452-3
704
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
luppatore per tre minuti. Anche in questo caso tutte le discontinuità presenti
sui pannelli sono state rilevate. Esito
positivo è stato ottenuto anche applicando la stessa procedura al blocco
campione di alluminio.
La terza prova è stata effettuata a temperatura di 100 °C impiegando i seguenti prodotti:
r liquido penetrante a contrasto di
colore K71B2.BIO;
r sviluppatore DWS2.
Il campione è stato posto in forno fino
a raggiungere la temperatura superficiale di prova di 100 °C, (Fig. 4).
Ottenuta la temperatura di prova, il
campione viene estratto e sulla superficie viene applicato con pennello il
penetrante da testare.
Figura 5 - Prova eseguita a 100 °C su flangia
forgiata con Elite K71B2p e sviluppatore
D112A
Abbiamo provato per voi...
Figura 6 - Prova eseguita a 100 °C su giunto saldato con Elite K71B2.BIO e sviluppatore DWS2
Successivamente viene reintrodotto il
pannello all’interno del forno per il
tempo di penetrazione indicato dal
fabbricante (3 minuti).
Segue la normale procedura per la
rimozione dell’eccesso di penetrante,
con panno inumidito con acqua e l’applicazione dello sviluppatore DWS2
con metodo spray. Il pannello viene inserito nuovamente all’interno del forno per 3 minuti di tempo di sviluppo.
L’esame visivo finale è stato positivo:
tutte le discontinuità presenti sul pannello di prova sono state evidenziate.
Dopo l’esecuzione delle prove a caldo,
i liquidi penetranti K71B2p e K71B2.
BIO sono stati applicati su una flangia
forgiata in acciaio inossidabile e su un
giunto saldato (materiale base in acciaio al carbonio e zona fusa in acciaio inossidabile). Entrambi i campioni
sono stati testati alla temperatura di
100 °C (Figg. 5 e 6).
Figura 7 - Prova di sensibilità eseguita a 0 °C
con Elite K71B2.BIO e DWS2 su blocco di
riferimento tipo 1 da 30 μm secondo ISO
3452-3
La procedura, eseguita in modo analogo a quella dei blocchi di riferimento
di tipo 1, ha evidenziato correttamente, in maniera ben definita e contrastata, tutte le discontinuità non artificiali
presenti sui campioni: le due cricche
sulla superficie della flangia e le numerose cricche presenti in zona fusa
del giunto saldato.
di riferimento in alluminio secondo
ASME V articolo 6.
I blocchi sono stati introdotti nella cella termostatica per il raggiungimento
della temperatura di prova di 0 °C,
successivamente è stato applicato il
liquido penetrante.
Dopo 20 minuti di tempo di penetrazione è stato rimosso l’eccesso di penetrante con il solvente BC1, infine è
stato applicato lo sviluppatore D112A
per 10 minuti, mantenendo costante la
temperatura a 0 °C.
In tutti i campioni si sono evidenziate le imperfezioni presenti. Tale test
dimostra che il liquido penetrante
K71B2p ha sensibilità di livello 2, secondo norma ISO.
6.3 Prove a temperatura
inferiore a 10 °C
La seconda prova è stata effettuata
sempre a temperatura di 0 °C impiegando i seguenti prodotti:
r liquido penetrante a contrasto di
colore K71B2.BIO;
r remover BC1;
r sviluppatore DWS2.
Tutti i difetti presenti sui blocchi di riferimento sono stati rilevati (Fig. 7).
La sensibilità di esame è di livello 2,
secondo norma ISO.
La prima prova è stata effettuata a
temperatura di 0 °C impiegando i seguenti prodotti:
r liquido penetrante a contrasto di
colore K71B2p;
r remover BC1;
r sviluppatore D112A.
La procedura è stata eseguita utilizzando i blocchi di riferimento di tipo
1 (secondo standard ISO) e il blocco
Infine è stata eseguita una prova utilizzando entrambi i prodotti, alla stessa
temperatura, sulla flangia contenente
cricche non artificiali (Fig. 8).
L’esame visivo finale ha correttamente
messo in evidenza entrambe le cricche
presenti sulla superficie della flangia.
Nella successiva Tabella 1 sono riportati i risultati delle prove di sensibilità
fino a questo punto eseguite.
Figura 8 - Prova eseguita a 0 °C su flangia
forgiata con Elite K71B2p e sviluppatore
D112A
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
705
Abbiamo provato per voi...
Temperatura
di prova
[°C]
Tempo di
penetrazione
[min]
Tempo di
lavaggio
[min]
Tempo di
sviluppo
[min]
% di intagli
evidenziati sul
pannello di tipo
1 secondo
ISO 3452-3
% di cricche
rilevate su blocco
di riferimento
ASME V art. 6
Livello di
sensibilità
secondo
ISO 3452-2
10 - 50
5
n. a.
5
100
100
2
0
20
n. a.
10
100
100
2
100
3
n. a.
3
100
100
2
10 - 50
5
1
5
100
100
2
K71B2.BIO
DWS2
0
20
1
10
100
100
2
K71B2.BIO
DWS2
K71HT
RHT
D200
K71HT
RHT
D200
100
3
1
3
100
100
2
100
3
n. a.
3
100
100
2
200
1
n. a.
1
100
100
2
Prodotti
K71B2p
BC1
D112A
K71B2p
BC1
D112A
K71B2p
BC1
D112A
K71B2.BIO
DWS2
7. Lavabilità
Dopo ogni esame è sempre opportuno
pulire accuratamente i pezzi ispezionati, al fine di eliminare possibili residui
del controllo (penetrante o rivelatore
intrappolati negli interstizi) ed evitare
eventuali inestetismi, problematiche in
ulteriori lavorazioni termo-meccaniche e principi di corrosione. Proprio
per non sottovalutare questa fase del
procedimento di controllo sono state
eseguite in ultimo prove di lavabilità
impiegando i seguenti materiali:
r liquidi penetranti Elite K71B2p,
K71B2.BIO e K71HT;
r sviluppatori Elite D112A, DWS2 e
D200.
Si sono utilizzati blocchi di lavabilità con rugosità di circa 5 Ra e getto
Figura 9 - Prova di lavabilità – applicazione
del liquido penetrante su blocchi di lavabilità
706
d’acqua fredda (Fig. 9). Dopo aver applicato sui pannelli i liquidi penetranti e gli sviluppatori suddetti e atteso
15 minuti di tempo di applicazione, i
campioni sono stati lavati con un getto
d’acqua. Si è riscontrato che il lavaggio con acqua fredda è stato sufficiente
a eliminare completamente la presenza dei consumabili e di possibili aloni
sui pannelli utilizzati (Fig. 10).
I prodotti testati sono infatti facilmente
asportabili dalle superfici di contatto;
un vantaggio che permette una sensibile riduzione dei consumi d’acqua
Figura 10 - Prova di lavabilità - Sviluppatore
bianco D112A (a destra) a confronto con altro sviluppatore bianco (a sinistra) dopo il
lavaggio
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
nelle diverse fasi del procedimento di
controllo, una ridotta quantità di acque reflue da trattare e di conseguenza
una diminuzione complessiva dei costi
e dei tempi di controllo.
8. Conclusioni
È stata effettuata dai tecnici IIS una
serie di prove per la verifica della sensibilità e della lavabilità di alcuni prodotti della gamma Elite per controllo
con liquidi penetranti. Per l’esecuzione dei test si sono utilizzate piastrine
campione aventi difetti "normalizzati"
e campioni con difetti non artificiali.
La linea di consumabili presa in esame risulta essere versatile e di elevata
sensibilità a differenti temperature di
prova. Degno di nota è il penetrante
K71B2.BIO, abbinato allo sviluppatore bianco DWS2 che, oltre ad offrire un
elevato livello di sensibilità di esame,
ha il vantaggio di utilizzare acqua anziché solventi infiammabili. L’innovazione di questi prodotti “water base”
è nella sicurezza: meno rischi legati al
trasporto, immagazzinamento e utilizzo del prodotto, ma anche meno costi
legati al trattamento delle acque di lavaggio: l’acqua diventa il componente
principale insieme a miscele di tensioattivi biodegradabili.
Abbiamo provato per voi...
Nella tabella seguente si riporta infine la valutazione complessiva relativa alle prove effettuate ed ai risultati ottenuti dai
singoli prodotti.
Documentazione
tecnica fornita
Confezionamento,
etichettatura
ed informazioni
cogenti
Completezza e qualità delle
informazioni
Vengono fornite in lingua italiana e inglese:
‡ 6FKHGH WHFQLFKH 7'6 GHÀQLVFRQR LQ PRGR FKLDUR H FRPSOHWR OD
descrizione del consumabile e la sua applicazione.
‡ 6FKHGHGLVLFXUH]]D6'6
‡ &HUWLÀFDWLGLDQDOLVL7HVW&HUWLÀFDWHSHURJQLORWWRGLSURGX]LRQHFRQ
riferimento alle normative vigenti, applicabili. Comprendono anche le
ULFKLHVWHGLDQDOLVLVSHFLÀFKHSHUO·XWLOL]]RQHOVHWWRUHQXFOHDUH
Riferimenti tecnici
Proprietà e norme sono citate in modo esaustivo ed aggiornato.
Confezionamento
,OFRQIH]LRQDPHQWRqDGHJXDWRDOO·XWLOL]]RGHOSURGRWWR
I prodotti vengono forniti in tanica, fusti o nella pratica bomboletta spray.
Etichettatura
/·HWLFKHWWDWXUDqLQOLQJXDLWDOLDQDHLQOLQJXDLQJOHVH
Le etichette sono chiare e leggibili, contengono il numero di lotto e le
informazioni di sicurezza applicabili.
Scadenza dei prodotti
Viene indicata la data di produzione e di scadenza.
I prodotti hanno scadenza:
‡ DQQLSURGRWWLLQWDQLFDHIXVWL
‡ DQQLSURGRWWLLQERPEROHWWH
Schede di sicurezza
Sensibilità conforme a
ISO 3452-2
ASME V articolo 6
ASTM E1417
WHPSHUDWXUHVWDQGDUG
Caratteristiche del
consumabile
Sensibilità conforme a
ISO 3452-5
ASME V articolo 6
ASTM E1417
WHPSHUDWXUHDOWH
Le schede di sicurezza sono chiare e complete e conformi, in tutti i punti
previsti ed aggiornate alla normativa REACH vigente.
‡
‡
‡
‡
‡
‡
Il gruppo di consumabili K71HT, RHT e D200 ha mostrato sensibilità
livello 2.
Il gruppo di consumabili K71B2p, BC1 e D112A ha mostrato sensibilità
livello 2.
Il gruppo di consumabili K71B2.BIO e sviluppatore DWS2 ha mostrato
sensibilità livello 2.
Sensibilità conforme a
ISO 3452-6
ASME V articolo 6
ASTM E1417
WHPSHUDWXUHEDVVH
‡
Caratteristiche del liquido
penetrante rosso
Elite K71B2p, K71B2.BIO e K71HT si lavano molto facilmente dalle
VXSHUÀFLVHQ]DODVFLDUHDORQLHUHVLGXL
&Lz VLJQLÀFD ULGX]LRQH GHL WHPSL GL ODYDJJLR PLQRUH FRQVXPR G·DFTXD H
ULGRWWDTXDQWLWjGLDFTXHUHÁXHGDWUDWWDUH
‡
‡
Caratteristiche
funzionali ed
operative
La famiglia di prodotti K71B2p, BC1 e D112A ha mostrato sensibilità
livello 2.
La famiglia di prodotti K71B2.BIO, BC1 e D112A ha mostrato sensibilità
livello 2.
Il liquido penetrante K71B2.BIO, con lo sviluppatore DWS2, ha mostrato
VHQVLELOLWjOLYHOOR/LYHOORGLFKLDUDWRGDOSURGXWWRUH
Caratteristiche degli
sviluppatori
‡
Sicurezza
Il gruppo di consumabili K71B2p, BC1 e D112A ha mostrato sensibilità
livello 2.
Il gruppo di consumabili K71B2.BIO e sviluppatore DWS2 ha mostrato
sensibilità livello 2.
Sviluppatore Elite D112A, in tanica da 10 litri, richiede solo una breve
DJLWD]LRQHSHUWRUQDUHLQVRVSHQVLRQHFRPHULFKLHVWRGD$06(
H ULPDQH RPRJHQHR SL D OXQJR IDFLOLWDQGR O·DSSOLFD]LRQH FRQ SLVWROD
a spruzzo, in uno strato sottile e uniforme come richiesto da tutte le
VSHFLÀFKH
,QROWUH q IDFLOPHQWH ULPRYLELOH $06 ( GRSR LO FRQWUROOR VLD
secco con stracci che con acqua a pressione di rete, con conseguente
risparmio di tempo e acqua.
Gli sviluppatori DWS2 e D112A sono facilmente lavabili con getto
G·DFTXDGLUHWHVHQ]DODVFLDUHDORQLHVRWWRIRQGL
Elite K71B2.BIO liquido penetrante base acqua con sviluppatore in
sospensione acquosa DWS2 garantiscono la massima sicurezza per
O·RSHUDWRUHLQTXDQWRSULYLGLLQGLFD]LRQLGLSHULFRORVLWjHQRQLQÀDPPDELOL
Basso impatto ambientale.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
707
SEATEC E’ MEMBRO DI:
QUALITEC
DESIGN AWARD
components
production & furniture
QUALITEC
TECHNOLOGY AWARD
ABITARE
LA BARCA
11
seatec
Targa
Rodolfo Bonetto
COMPOTEC
5
06/08 FEBBRAIO 2013 CARRARA
seatec
compotec
5
RASSEGNA INTERNAZIONALE
TECNOLOGIE, SUBFORNITURA
E DESIGN PER IMBARCAZIONI,
YACHT E NAVI
RASSEGNA INTERNAZIONALE
COMPOSITI E TECNOLOGIE
CORRELATE
www.sea-tec.it
www.compotec.it
SPONSOR UNICO BANCARIO:
CON IL PATROCINIO DI:
REGIONE
TOSCANA
11
ORGANIZZATORE:
GRUPPO BANCA CARIGE
PR O M OZ I ON E
C.C.I.A.A.
DI MASSA CARRARA
Cassa
di Risparmio
di Carrara S.p.A.
Business on the Move
CarraraFiere, Viale Galileo Galilei, 133 - 54033 Marina di Carrara (MS) - Italy - Tel. +39 0585 787963 Fax +39 0585 787602 - e-mail: [email protected]
Technology is life
=
A
V¥¤
K?PICRGLE
QC?PAF
KQGRC
J
WLQ
PP
BILE A
MO
SE
O
web
ma
rke
g
tin
62&,$/0
e book
HP
DLO
P
DU
NH
^
A
OLW\
HGUHD
HQW
P
J
DX
(',$
0$
5.
(7 ,
1*
Agenzia di Comunicazione
STRATEGIA I GRAFICA I COPYWRITING I EDITORIA I WEB I MULTIMEDIA I PUBBLICITÀ I UFFICIO STAMPA I EVENTI
Via G. Biancardi, 2 - 20149 Milano
02 8945 9724 @ [email protected]
www.mediavalue.it
facebook.com/mediavaluemilano
Dalle
Aziende
Nuovo procedimento ICE™,
Integrated Cold Electrode
Drastico aumento di produttività con
la rivoluzionaria tecnologia ESAB
per la saldatura SAW
Hannes Raudsepp M. Sc.,
IWE Chief Engineer ICE ESAB Global Automation
&RPSDUDQGR L WDVVL GL GHSRVLWR ÀQR DG
oggi la tecnica Twin-arc è stata il procedimento di saldatura ad arco sommerso
(SAW) più produttivo basato su un generatore singolo.
La saldatura Twin-arc viene effettuata con
GXHÀOLDOLPHQWDWLGDOORVWHVVRJHQHUDWRUH
con polarità uguale.
Con il procedimento ICE™ sviluppato e
brevettato da ESAB, è possibile aumenWDUH LO WDVVR GL GHSRVLWR ÀQR DO LQ
FRPSDUD]LRQH FRQ7ZLQDUF H GHO ULVSHWWRDOÀORVLQJROR
La tecnologia ICE™ è lo sviluppo più avanzato del procedimento SAW, con un terzo
ÀOR IUHGGR HOHWWULFDPHQWH LVRODWR DGGL]LRQDWR LQ SDUDOOHOR WUD L GXH ÀOL HOHWWUL]]DWL
Figura 1 - Torcia di saldatura ICE™
detti “caldi”, nella stessa torcia di saldatura.
/DYHORFLWjGLDOLPHQWD]LRQHGHOÀORIUHGdo viene controllata in modo indipendenWHGDLGXHÀOLFDOGLPHGLDQWHXQVRIWZDUH
integrato nel pannello ESAB PEK per il
FRQWUROORGHOSURFHVVR,OÀORIUHGGRIRQGH
sfruttando l’energia in eccesso generata
GDOODIXVLRQHGHLGXHÀOLFDOGL
introducono il filo freddo separatamente richiedono un controllo estremamente accurato per poter funzionare correttamente.
L’esperienza ha dimostrato che queste
soluzioni non sono sufficientemente
robuste e affidabili per poter costituire
un sistema efficiente nella gran parte
delle applicazioni.
Introduzione
Il procedimento di saldatura ad arco
sommerso con l’aggiunta di un filo
freddo non è un metodo nuovo per migliorare la produttività.
Esistono infatti diverse soluzioni tecniche per introdurre un filo freddo nel
bagno di fusione, con differenti prestazioni e aree di applicazione.
Queste soluzioni prevedono l’immissione del filo freddo nel processo mediante un dispositivo separato, con
un certo angolo rispetto al filo caldo.
Questa impostazione presenta diversi
problemi, il più rilevante dei quali riguarda la stabilità del processo.
Per esempio, se lo stick-out varia o
l’arco diventa instabile, il punto di
fusione del filo freddo cambia, con
l’effetto che il processo di saldatura
diventa molto sensibile ad ogni variazione che riguarda l’arco.
In ambiente produttivo, soluzioni che
ICE™ – Stabilità del processo
L’integrazione del filo freddo nello
stesso dispositivo di contatto e la collocazione in parallelo con i fili caldi
contribuisce all’affidabilità e alla stabilità del processo.
L’aggiunta del filo freddo con la tecnologia ICE™ produce archi e bagno di
saldatura più calmi e stabili.
ICE™ rende il processo meno sensibile ai cambiamenti degli archi e dello
stick-out perché il punto di fusione del
filo freddo viene continuamente adattato ai due archi. La migliore stabilità
del processo consente di regolarlo e
adattarlo facilmente ai differenti tipi
di giunti. La stabilità del procedimento ICE™ inoltre permette di utilizzare
parametri e velocità di saldatura più
elevati rispetto ai procedimenti SAW
convenzionali, con evidenti vantaggi
in produttività.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
711
Dalle Aziende Features
TABELLA 1 - Comparazione dei tassi di deposito
ICE™ - Vantaggi del processo
r
r
r
r
r
r
r
Aumento del tasso di deposito;
Velocità di saldatura più elevata;
High Deposition Root™;
Riduzione del consumo di flusso;
Flat Cap Control™;
Minori deformazioni grazie ad un
apporto di calore ridotto;
Risparmio di energia.
ICE™ - ProÀlo del giunto e
caratteristiche meccaniche
In confronto con il procedimento di
saldatura Twin-arc, utilizzando gli
stessi parametri, e con una percentuale tra 10-100% del rapporto delle
velocità filo freddo/filo caldo, il profilo
di penetrazione non cambia variando
la quantità di filo freddo. Mantenendo
inalterati i parametri con l’aggiunta
del filo freddo, le caratteristiche del
deposito sono anch’esse le stesse.
Questo significa che la penetrazione e
la larghezza del deposito sono le stesse della saldatura SAW convenzionale.
L’altezza del cordone o del sovrametallo vengono aumentate, con una distribuzione su tutta la larghezza del
cordone. L’aumento degli angoli riduce il riscaldamento dell’area, con migliori caratteristiche meccaniche grazie alla riduzione della dimensione dei
grani. Con lo stesso apporto di calore,
le caratteristiche meccaniche dei giunti saldati con ICE™ sono dello stesso
livello di quelli convenzionali SAW.
Utilizzando il procedimento ICE™ per
modificare il profilo di penetrazione,
le caratteristiche meccaniche possono
essere migliorate.
ICE™ - Aumento del tasso di
deposito con lo stesso apporto di
calore
In tutti i procedimenti di saldatura,
SAW compreso, l’apporto di calore
limita la produttività. L’apporto di calore che il materiale base può sopportare costituisce infatti il limite.
Con il procedimento ICE™ non serve
cambiare l’apporto totale di calore
per incrementare il tasso di deposito o
per ottenere altri vantaggi.
ICE™ infatti utilizza l’energia eccedente del processo per fondere ulteriore
filo e incrementare così il tasso di deposito. L’apporto di calore rimane invariato addizionando diverse quantità
di filo freddo. Il calcolo dell’apporto di
calore non prende infatti in considerazione l’aggiunta di filo freddo.
Formula dell’apporto di calore:
Q [ kJ / mm ]
Figura 2 - ICE™ 3*2,5 mm, 35 V 50% cwfr
712
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
K SAW I [ A] U [V ] * 60
WS [ mm / min] * 1000
Dalle Aziende Features
Figura 3 - Giunto d’angolo, gola 5 mm, velocità saldatura 2000 mm/min. Tasso di deposito 24 kg/h, apporto di calore 1,19 kJ/mm
La ricerca ed i test hanno dimostrato
che la nostra teoria è corretta e che
l’apporto di calore non cambia con
l’addizione di filo freddo.
Le altre teorie che ritengono che il filo
freddo “raffreddi” la fusione o che
crei un “pozzetto di calore” sono state smentite. Confrontando ICE™ con
la saldatura a filo singolo, il tasso di
deposito può essere incrementato fino
al 100%, e fino al 50% in confronto
con Twin-arc, con lo stesso apporto di
calore. Il tasso di deposito più elevato
che ICE™ può produrre con un generatore singolo è di 34 kg/h.
La Tabella 1 mostra i limiti del tasso di
deposito (giallo) per le differenti configurazioni ed i tassi di deposito comunemente usati (verde).
Queste aree verdi si possono considerare le zone di totale tranquillità del
processo.
Figura 5 - High Deposition Root™ 30,2 kg/h,
apporto di calore 3,2 kJ/mm, spessore 25 mm
Figura 4 - Giunto testa-testa da un lato su lamiera da 10 mm, velocità saldatura 1400 mm/min.
Tasso di deposito 23,9 kg/h, apporto di calore
2,03 kJ/mm
Si può notare che il procedimento
ICE™ con un solo generatore può depositare di più rispetto a un Tandem
con fili singoli. Se disponete di un Tandem e installate le teste ICE™, potrete
raddoppiare il tasso di deposito.
ICE™ – Velocità di saldatura più
elevata
L’effetto stabilizzante del procedimento ICE™ permette di incrementare
notevolmente la velocità di saldatura
mantenendo lo stesso apporto di calore, oppure di aumentare la velocità
e ridurre l’apporto di calore. Nelle
applicazioni e nei giunti convenzionali
la velocità di saldatura può essere aumentata fino oltre 1000 mm/min senza
alterare l’apporto di calore e la stabilità del processo. Con ICE™ si possono
oggi raggiungere velocità dell’ordine
di 2000 mm/min.
ICE™ – High Deposition Root™
L’effetto stabilizzante del procedimento ICE™ permette inoltre di raggiungere un’elevata produttività nelle
passate di radice, con tassi di deposito
intorno ai 25 kg/h senza la necessità di
rimuovere le saldature di puntatura o
di sigillatura.
Nella configurazione ICE™ tandem è
possibile modificare il profilo di penetrazione del giunto nella passata di
fondo. Il procedimento ICE™ cambia il
profilo del bagno di saldatura e cambia la direzione del fronte di solidificazione, consentendo di controllare
il profilo di penetrazione in un modo
nuovo. Nella configurazione Tandem,
High Deposition Root™ può essere
usato in applicazioni con una passata
singola, oppure come passata di fondo
per grossi spessori.
La superficie del giunto presenta una
Figura 6 - High Deposition Root™, tasso di
deposito 25 kg/h, flusso OK Flux 10.72
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
713
Dalle Aziende Features
Figura 7 - Scoria prodotta dal flusso OK Flux
10.72
forma concava, con eccellenti caratteristiche di rimozione della scoria con
flussi sia ad alta che a bassa basicità.
ICE™ - Riduzione del consumo di
Áusso
Saldare in modo più produttivo con
il procedimento ICE™ e completare il
giunto con un numero inferiore di passate significa che il consumo di flusso
viene notevolmente ridotto.
La stabilità del processo inoltre consente di ridurre il quantitativo di flusso
fuso per kg di metallo depositato.
Nella configurazione ICE™ tandem,
in confronto con una configurazione
tandem convenzionale il consumo di
flusso si riduce approssimativamente
del 20%, a parità di apporto di calore. Confrontando ICE™ tandem con il
sistema a filo singolo, la riduzione del
consumo di flusso raggiunge il 45%.
Aumentando la velocità di saldatura si
ottiene sempre un risparmio del consumo di flusso, ma l’entità varia da
caso a caso.
La rimozione della scoria con ICE™
risulta sempre eccellente, indipendentemente dalla basicità del flusso,
mentre la superficie del cordone è più
dolce e regolare rispetto al processo
SAW convenzionale.
Figura 8 - Superficie del giunto
piatto con ICE™ risulta più facile che
con i processi convenzionali. Dato che
il filo freddo non è un parametro attivo, la sua quantità può essere regolata
durante la saldatura senza variare l’energia immessa nel processo. In altre
parole, sempre rispettando i limiti della WPS. Cosa avviene normalmente?
Se in un giunto avete un deposito che
non raggiunge il livello del materiale
base, dovrete effettuare un’altra passata, che magari dovrà essere molata
perché il sovrametallo risulterà eccessivo. Potreste invece diminuire la
velocità di saldatura per migliorare
il riempimento, con la conseguenza di
un apporto termico troppo elevato e di
caratteristiche meccaniche inferiori.
Ottenere un giunto piatto con ICE™ risulta invece molto più facile, regolando opportunamente la quantità di filo
freddo durante la saldatura.
ICE™ - Meno deformazioni
grazie al minor apporto termico
L’incremento del tasso di deposito e la
migliore stabilità del processo consentono di saldare più velocemente e con
un apporto termico minore rispetto ai
procedimenti a filo singolo o twin.
Regolando ICE™ per ottenere lo stesso livello di produttività e saldando
più velocemente, l’apporto termico si
riduce.
Un minor apporto termico causerà minori deformazioni, con grandi
ICE™ - Flat Cap Control™
Un giunto con superficie piatta non è
una novità, tuttavia ottenere un giunto
714
Figura 9 - Flat Cap Control™. Altezza del sovrametallo 0,5 mm
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
Dalle Aziende Features
vantaggi specialmente saldando lamiere sottili e materiali base sensibili
agli apporti termici elevati.
ICE™ - Risparmio di energia
Il procedimento ICE™ utilizza l’energia eccedente disponibile nel processo
per fondere maggiori quantità di filo.
Questo significa una riduzione del
consumo di energia e dei relativi costi.
ICE™ può ridurre il consumo di energia e dei costi fino al 33%, in confronto con la saldatura Twin-arc.
Confrontando il procedimento SAW a
filo singolo con ICE™ in tandem (singolo DC + ICE™ AC) la riduzione di
consumo può raggiungere il 50%.
ICE™ - Fili e Áussi
Il procedimento ICE™ è stato sviluppato utilizzando fili e flussi ESAB.
Le combinazioni di filo e flusso impiegate con ICE™ sono prodotti standard
che ESAB produce normalmente per
tutti i tipi di applicazioni, e non sono
necessarie particolari combinazioni di
filo e flusso per ottenere i benefici offerti dal procedimento ICE™.
ICE™ - Vantaggi e beneÀci
complessivi
Prendiamo ad esempio un giunto di testa su lamiere da 40 mm di spessore,
cianfrino a doppio V 1/3 2/3, angolo
incluso di 60°, S355NL.
Comparando la configurazione ICE™
tandem (filo da 4 mm + ICE™) con un
tandem costituito da due fili da 4 mm, i
vantaggi sono evidenti:
r Incremento del tasso di deposito
del 150%;
r Tasso di deposito di circa 30 kg/h;
r Velocità di saldatura 1000 mm/min;
r Consumo di flusso ridotto di oltre
il 20%;
r Risparmio di energia del 50%;
r 7% di filo in meno, grazie a Flat
Cap Control™, 1 mm.
Nei giunti stretti, l’effetto stabilizzante
di ICE™ consente di ottenere un’elevata produttività oltre ad ottime caratte-
Figura 10 - Giunto su lamiere da 40 mm, S355NL, saldato con Tandem 4 mm DCEP 3*2,5 mm
ICE™ AC. Apporto di calore 3,3 kJ/mm
ristiche meccaniche. Con ICE™ si può
saldare con elevata produttività in configurazioni di giunti stretti con angoli
inclusi a partire da 8 gradi, con tassi
di deposito fino a 30 kg/h, pur mantenendo l’apporto di calore al disotto
di 3 kJ/mm e garantendo le prestazioni
del giunto fino a -60°.
Molti giunti stretti vengono oggi saldati con filo singolo oppure con due fili
singoli in Tandem.
Confrontando una configurazione a
filo singolo da 4 mm con la soluzione
ICE™ Tandem (filo da 4 mm + ICE™),
in un giunto su lamiere S355G8+M,
angolo di cianfrino incluso 22 gradi,
limite di apporto di calore 3,5 kJ/mm,
il procedimento ICE™ per le passate di
riempimento aumenta considerevolmente la produttività:
r Incremento del tasso di deposito
del 250%;
r Tasso di deposito di 28 kg/h;
r Velocità di saldatura 850 mm/min;
r Consumo di flusso ridotto del
45%;
r Risparmio di energia del 10%.
ICE™ - Calcolo dei vantaggi
Qualche volta può essere difficile valutare i benefici dovuti all’implementazione di una nuova tecnologia.
Per facilitare questa analisi, gli specialisti ESAB nell’applicazione del
procedimento ICE™ sono a vostra disposizione per aiutarvi a valutare il
miglior uso della tecnologia nelle diverse applicazioni, sviluppando procedure ottimizzate, instaurando calcoli
sui benefici per stimare i vantaggi attesi e valutare la realizzazione pratica
dei nuovi procedimenti. La tecnologia
ICE™, con fili e flussi ESAB, permette
di realizzare la soluzione più produttiva di saldatura SAW ottenibile da
un unico fornitore-partner, che rende
agevole introdurre la tecnologia e realizzare quei vantaggi che nessun altro
procedimento SAW può uguagliare.
ESAB Saldatura SpA
Via Novara 57/59
20010 Bareggio - MI
Tel. 02 979681
www.esab.it
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
ModenaFiere
31 Gennaio - 1 Febbraio 2013
Materiali innovativi, tecnologie, prodotti e servizi per veicoli,
motori da competizione e ad alte prestazioni
per auto, moto, kart, nautica e avio.
STUDIONO.IT
www.motorsportexpotech.it
.PUPSTQPSUÒVONBSDIJPEJ3FBMJ[[BUPJOQBSUOFSTIJQDPO
WJBMF7JSHJMJP#t.PEFOB
QI̓rGBY
TFHSFUFSJB!NPUPSTQPSUFYQPUFDIJU
Nuova Collana di “DVD Tecnici”
La nuova normativa europea ed
internazionale sul controllo radiografico
di giunti saldati con tecnologia digitale
SEMINARIO TECNICO
GENOVA 28 GIUGNO 2012
Questo Seminario ha l’obiettivo, da una parte, di aggiornare i partecipanti sullo stato dell’arte delle tecniche digitali (filmless) riconosciute a livello normativo e, in particolare, della tecnica nota come Computed Radiography
(CR), la cui rapida evoluzione ne ha fatto, negli ultimi
anni, una possibile alternativa ai tradizionali supporti, e,
dall’altra parte, di analizzare la recente normativa tecnica
europea (EN) ed internazionale (ISO) in materia, soffermandosi, nella fattispecie, su quanto viene prescritto in
merito alla classificazione e qualificazione dei sistemi CR
e delle tecniche di esposizione relative.
Il Seminario è rivolto principalmente agli operatori che svolgono le funzioni
caratteristiche dei livelli di qualificazione 2 e 3 nel metodo radiografico, come anche ad Ispettori di saldatura in possesso di qualificazioni o specializzazioni nel campo dell’esame radiografico.
Programma del Seminario
x
x
x
Principi generali del controllo radiografico con tecniche digitali
(filmless);
Norme generali di metodo per le tecniche digitali (filmless): EN 14784
(parti 1, 2), ISO DIS 16371;
Norme relative ai giunti saldati per le tecniche digitali (filmless): ISO
DIS 17636 (parti 1, 2);
Settore DDC
Maura Rodella
Lungobisagno Istria,15
16141 Genova
tel. 010 8341385
fax 010 8367780
Email:[email protected]
www.weldinglibrary.com
Codice: 101517; Prezzo € IVA 21%
Prezzo speciale 30% Sconto: € 49,00 + IVA 21%
Dalle Aziende
Weldline, Magswitch:
morsetti di massa
e posizionatori magnetici
con controllo del magnetismo
I prodotti MAGSWITCH, commercializzati in Italia con il marchio
WELDLINE del Gruppo AIR LIQUIDE
Welding, sono dei magneti permanenti
che permettono di controllare il magnetismo (on-off), con una semplice
rotazione della manopola, senza far
uso di corrente.
Sebbene i magneti siano utilizzati da
lungo tempo nei procedimenti di saldatura e fabbricazione, non trovano
largo impiego poiché spesso si ritiene
che presentino problemi di uso e pulizia. Tutto questo è un ricordo del passato, adesso la forza di questi prodotti
permette di velocizzare le operazioni
di bloccaggio dei pezzi anche in lavori
complessi.
MAGSWITCH offre molteplici e importanti vantaggi: maggiore produttività grazie ai tempi più brevi di
approntamento, comodità derivante
dall’utilizzo agevole, sicurezza perché
c’è sempre meno bisogno di usare le
mani per spostare e posizionare le lamiere calde o taglienti.
Maggiore produttività per due ragioni:
1.
Non si deve più perdere del tempo utile nel fissare e bloccare le
lamiere
2. Non è più necessario usare staffe,
viti o altro che possano rovinare
le lamiere e richiedere un intervento successivo di molatura o
smerigliatura.
MAGSWITCH è, fondamentalmente,
una soluzione che migliora l’efficienza
produttiva.
WELDLINE
13 rue d’Epluches
Saint-Ouen l’Aumône BP 70024
95 315 Cergy Pontoise Cedex
Tel. : +33 1 34 21 33 33
[email protected]
www.weldline-alw.com
Fro-Air Liquide Welding
è Partner della Campagna Europea
Ambienti di Lavoro Sani
2012–2013
Air Liquide Welding è un partner della campagna Ambienti di lavoro sani
2012-2013, “Lavoriamo insieme per
la prevenzione dei rischi” organizzato
dall’Agenzia europea per la sicurezza
e la salute sul lavoro (EU-OSHA).
Il tema della campagna per il 2012-
2013, “Lavoriamo insieme per la prevenzione dei rischi” è molto apprezzato da Air Liquide Welding.
La nuova campagna incoraggia i manager, lavoratori, rappresentanti e
altri soggetti interessati a lavorare insieme per gestire i rischi sul luogo di
lavoro. Garantire Ambienti di lavoro
sani e sicuri è parte integrante della
volontà di AIR LIQUIDE Welding che
da sempre si impegna a costruire un
successo economico basato su un modello di futuro sostenibile.
Air Liquide Welding è stato in passato
un partner di EU-OSHA su precedenti
campagne: “Ambienti di lavoro sani”.
Questa adesione alla nuova campagna
Ambienti di lavoro sani è una grande
opportunità per tutta l’organizzazione,
attraverso la costruzione di partnership con altre aziende e associazioni
impegnate in tematiche di SSL, nonché
la possibilità di condividere le buone
pratiche e di utilizzare la campagna
per sostenere e promuovere le proprie
attività. I vantaggi di essere un partner della campagna sono tangibili, e
va nella direzione di una maggiore visibilità e opportunità per tutta l’organizzazione di Gruppo.
FRO-Air Liquide Welding Italia SpA
Via Torricelli, 15/A
37136 Verona Italy
+39 045 82 91 511
www.saf-fro.it
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
719
Dalle Aziende
al tungsteno con liquido di recupero
polveri, liquidi antispruzzo, penetranti, masse rotanti, pinze porta elettrodo.
La garanzia della qualità ESAB è a vostra disposizione.
ESAB Saldatura SpA
Via Novara 57/59,
20010 Bareggio – MI
Tel 02 97968.1
www.esab.it
CLOOS,
Nuovo Armadio compatto
QIROX® Controller Basic
ESAB,
Tecnologia e sicurezza:
accessori e protezione
personale per saldatori
Da oltre cento anni leader nella saldatura e taglio metalli, ESAB sfrutta la
propria esperienza per offrire ai professionisti del settore prodotti specifici
in cui le tecnologie più avanzate e la
qualità migliore sono al servizio del
lavoro e della sicurezza.
PPE: Maschere ad oscuramento
automatico - Nuova Aristo Tech®
Le maschere ad oscuramento automatico hanno reso la saldatura non solo
più produttiva e pratica, ma anche più
sicura, liberando le mani del saldatore
e garantendo migliore protezione da
fumi e spruzzi. Spesso però la scarsa
qualità di molti prodotti sul mercato
impedisce di ottenere questi vantaggi.
ESAB fornisce da sempre, maschere
automatiche con le lenti della qualità
più elevata, una capacità di oscuramento ampia, omogenea e senza batterie interne. Oggi il catalogo si arricchisce della nuova Aristo Tech®, vera
maschera multi processo, con oscuramento da 5 a 13 DIN, adatta a Tig,
Mig/Mag, elettrodo e molatura. Leggerissima, con i suoi 450 g, permette la
selezione parametri con sistema quick
set. Disponibile in versione con erogatore portatile aria filtrata, casco protettivo, e maschera interna per molatura. Una maschera universale, pratica,
all’avanguardia e, come sempre, conforme ai più rigidi standard CE, ANSI,
AS/NZS, CSA.
720
PPE: Abbigliamento Antifiamma Tecnologia Phoenix®
ESAB è orgogliosa di presentare il risultato di anni di ricerca dedicata: il
nuovo abbigliamento in tessuto tecnico per saldatura Phoenix®. Questo
innovativo tessuto ha una struttura
molecolare resistente alla fiamma e
garantisce la migliore protezione con
il massimo comfort. Tutti i prodotti
Phoenix® soddisfano i requisiti: ISO
EN 11612, ISO EN 11611 liv. 1 e 2,
EN 1149/3/5, EN 61482/1/2 (abbigliamento antifiamma specifico per
saldatura). Tutte le normative sono
stampate su spalla e retro pantaloni per facilitare l’individuazione e la
verifica ispettiva. I prodotti vengono
consegnati con tabella delle normative
in ogni confezione.
PPE: Guanti per saldatura - ESAB
Mig e Tig “Arcuati”
Prodotto di vertice della gamma ESAB,
è disegnato per adeguarsi alla forma
anatomica della mano e realizzato
unendo oltre dieci lembi di pellame diverso per garantire una libertà nel movimento della mano mai raggiunta in
guanti con questi livelli di protezione.
Disponibile in versione Tig e Mig, con
le normative rispettate stampate sui
polsini, è l’essenza del credo ESAB:
Lavorare meglio per produrre di più.
Accessori di processo
Nel range ESAB, uno dei più vasti del
mercato, c’è una risposta tecnologicamente avanzata e di qualità per ogni
esigenza di processo. Forni di ricondizionamento e mantenimento programmabili, molatrici per elettrodi
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
Il nuovissimo Armadio di Controllo
CLOOS tipo “QIROX® Controller Basic” è stato studiato e sviluppato nel
corso di una attenta analisi dei costi
per offrire tutte le caratteristiche dei
collaudati dispositivi CLOOS ad un
prezzo molto più vantaggioso.
Potrà essere utilizzato come Controller di impianti compatti fino a 9 assi.
Il dispositivo di controllo è caratterizzato da un design compatto, le sue
dimensioni sono 800 x 1300 x 585 mm,
pur rispettando la normativa vigente.
Ciò assicura un utilizzo ancora più
semplice, oltre che una facile accessibilità per le operazioni di manutenzione. Tutte le caratteristiche più importanti, come la pulsantiera Touch
Screen dotata di grande schermo, la
tastiera, le interfaccia USB ecc., sono
disponibili esattamente come nella
versione standard “QIROX® Controller Advanced”. Ovviamente è possibile l’interfaccia con tutta la gamma di
saldatrici QINEO®. I cavi di connessione standard sono cavi a connessione fissa, ma sono anche disponibili,
come opzione, cavi di collegamento
assi spinati di qualsiasi lunghezza.
Possono naturalmente essere installati
tutti i tipi di sensori CLOOS come il
Dalle Aziende
gruppa la galassia dei prodotti Thermal Dynamics, Tweco, Arcair, Victor,
Ocim, Thermal Arc, Stoody, Turbo
Torch, oltre alla recente acquisizione
della finlandese Robotronic “ProMotion
Controls”, azienda leader nel settore
dell’elaborazione software e produzione di hardware per impianti di taglio
automatici.
sensore tattile (Touch Sensor), il sensore ad arco (Arc Sensor) e i sensori
Laser (Laser Sensor).
Grazie a queste numerose innovazioni
tecniche, CLOOS è in grado di offrire un robot di saldatura QIROX® con
payload di 15 kg e un armadio di controllo con un’ampia dotazione standard a prezzi veramente contenuti.
SALDOBRAZ ENGINEERING Srl
Dealer CLOOS Schweisstechnik Gmbh
Dealer HKS Prozesstechnik Gmbh
Via F. Coppi, 11
10043 Orbassano TO
Tel. 011 9019030
www.saldobraz.it
NDT Italiana,
i nuovi Liquidi Penetranti
“a caldo”
La Parte 5 e la Parte 6 della UNI EN
ISO 3452 riguardano rispettivamente i
liquidi penetranti “a caldo” (cioè sopra i 50 °C) e “a freddo” (cioè sotto
i 10 °C). La grande novità di queste
norme sta nel fatto che in entrambe si
precisa che spetta al produttore dei liquidi penetranti di effettuare le prove
di qualificazione dei prodotti indicando l’intervallo di temperatura e quindi,
citando la norma: “se i prodotti sono
utilizzati entro l’intervallo dichiarato,
non sono necessarie ulteriori prove sul
posto da parte dell’utilizzatore”.
L’onere delle prove e la responsabilità di classificazione e qualificazione
spetta quindi al produttore dei liquidi
penetranti. Alcuni problemi “pratici”
sorti nell’uso quotidiano hanno generato domande da parte di aziende:
“Sono stato chiamato per dei controlli, ma mi sono accorto che alcune
parti sono a temperature superiori a
50 °C mentre altre sono al di sotto di
tale temperatura limite... posso usare
comunque il vostro liquido penetrante
rosso e utilizzare quindi un solo prodotto durante il processo di controllo?
Se sì, fino a che temperatura massima
e minima?”. Per venire incontro a tali
esigenze, la NDT Italiana ha qualificato il proprio penetrante Elite K71B2p
per un uso ETR (Extended Temperature Range). Il K71B2p è qualificato
“IIACcde - 2 / 0 °C-100 °C ” cioè può
essere usato da 0 °C a 100 °C.
La sigla inoltre significa: Tipo II (rosso), Metodo A & C (rimovibili con
acqua o con remover), forma c, d/e
(sviluppatori sia a base solvente che a
base acqua), livello 2.
Rimangono sempre disponibili liquidi
penetranti formulati specificatamente
per “altissime” temperature: liquido
penetrante rosso Elite K71HT, sviluppatore bianco Elite D200, remover
Elite RHT (fino a 200 °C).
NDT ITALIANA Srl
Via del Lavoro, 28
20863 Concorezzo MB
Tel. (+39) 039.647590
[email protected]
www.ndt.it
Victor Technologies
ha inaugurato la
nuova sede italiana
L’azienda americana, pioniere nelle
tecnologie più avanzate di saldatura e
taglio dei metalli, investe risorse con
grande fiducia nel futuro dell’industria
Italiana. Come la storia ci insegna,
anche questo periodo di recessione finirà, e niente sarà più come prima.
Una delle poche certezze su cui possiamo contare è, infatti, che ci sarà futuro solo per le aziende che sapranno
rinnovarsi e migliorare la produttività.
Victor Technologies affronta decisamente la sfida inaugurando la nuova
sede Italiana di S.Giuliano Milanese,
una struttura completa di show room
per le dimostrazioni delle tecnologie
di saldatura e taglio, sala per training,
magazzini di apparecchiature e ricambi, oltre agli uffici commerciali e amministrativi.
Victor Technologies è il nuovo nome
di Thermadyne, una holding che rag-
“Il motivo principale della scelta del
nuovo nome”, dichiara Franco Monechi, General Manager Victor Technologies EMEA, “risiede nel fatto che
Thermadyne era la denominazione
della holding, non legata ad alcun
marchio di prodotto, mentre il marchio
Victor è legato a prodotti di grande
tradizione e successo, con particolare
enfasi sul mercato americano”.
E’ un ritorno alle radici, riprende infatti lo spirito pionieristico e incorpora le caratteristiche originali del
Marchio: autenticità, affidabilità,
innovazione ed un contatto profondo
con il mercato per capire le esigenze
dell’Utente finale. Tutti i marchi del
gruppo Victor sono infatti legati ad
aziende con svariati decenni di esperienza, che devono il loro successo ad
invenzioni originali dei loro fondatori,
veri pionieri delle tecnologie che hanno consentito di raggiungere il livello
attuale di qualità e affidabilità dei prodotti oggi sul mercato.
Il nuovo marchio riposiziona strategicamente l’Azienda sul mercato globale
come fornitore di soluzioni ad alta tecnologia nel taglio avanzato, la saldatura e le apparecchiature di controllo
dei gas. La presenza globale Victor
consiste in unità produttive dislocate
in Asia, America e Europa, 1500 dipendenti, con filiali dirette in più di 20
nazioni. Il fatturato è distribuito tra
clienti in 105 paesi, con attività crescente nei paesi emergenti, come Cina,
Brasile, Messico, Europa dell’Est.
In Europa l’organizzazione Victor può
contare su centri di produzione e distribuzione in UK e Italia, demo centers in Italia, UK ed Olanda, per un
totale di 70 dipendenti.
VICTOR TECHNOLOGIES EUROPE
Via Bolsena, 7
20098 S.Giuliano Milanese MI
Tel. 02 36546801
www.victortechnologies.com
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
721
Notiziario
Letteratura tecnica
ASM Handbook, Volume 6A:
Welding Fundamentals and Processes
Lienert T., Siewert T., Babu S. e
Acoff A.
Materials Park (OH-USA) 2011
227 x 290 mm, 850 pagine
ISBN 978-1-61503-133.7, $ 238,00
Questa nuova edizione del volume 6
“Welding Brazing and Soldering” della collana “ASM Hadbook” rappresenta il primo “6A” di almeno due volumi
che saranno pubblicati in futuro sulla
saldatura e sulle diverse tecniche di
giunzione.
Come già indicato nel titolo, il volume
6A è dedicato interamente agli aspetti
fondamentali della saldatura e dei molteplici processi.
Il volume 6B, di cui la pubblicazione è
prevista in un futuro non molto lontano, si concentrerà sulla saldabilità e sul
comportamento metallurgico di una
vasta gamma di acciai e di leghe non
ferrose. Riconosciuto che gli specialisti, i tecnici e gli studenti, potenzialmente interessati alla lettura di questo
volume, hanno esigenze diverse per
quanto riguarda il loro livello di comprensione e di conoscenze, di conseguenza le sezioni di questo manuale si
dividono in due grandi categorie.
Le sezioni fondamentali forniscono
un’approfondita analisi di base sui
principi scientifici, mentre le sezioni
rivolte ai vari processi tecnologici hanno un approccio più pratico.
Tutti i capitoli di questa nuova opera
sono stati notevolmente aggiornati ed
ampliati, riportando i risultati dei più
recenti sviluppi tecnici e scientifici,
in particolare sono state considerevolmente approfondite le parti riguardanti
i processi di saldatura ad energia concentrata, quelle dedicate alla saldatura allo stato solido e specialmente le
parti sullo studio della costruzione dei
modelli matematici. Inoltre sono stati
introdotti nuovi ed interessanti capitoli
sulla “friction stir welding”, sulla “magnetic pulse welding” e sui processi
ibridi. Il volume di indiscusso contenuto tecnico e scientifico, rappresenta
un notevole contributo ed un’opera di
consultazione e di riferimento fondamentale per tutti coloro che si occupano di saldatura.
The ASM Handbook Volume 6A,
“Welding Fundamentals & Processes”,
represents the first of at least two volumes to be published on aspects of
welding and joining. As indicated in
the title, Volume 6A focuses on fundamental aspects of welding, and on the
many welding processes. Volume 6B,
planned for future publication, will
concentrate on weldability and behaviour of a range of alloys and materials. As with the last edition of this
Volume, the Volume Editors recognized
that the researchers, engineers, technicians and students that will use this
handbook have different needs with
regard to their level of understanding.
Accordingly, the sections of this handbook fall into two major categories.
The sections on fundamentals provide
in-depth background on the scientific
principles associated with welding,
while the sections on the various welding processes take a more practical
approach. The Volume Editors have
also tried to present a comprehensive
reference that can be of use to the diverse welding community.
All sections of the handbook have been
reviewed to be sure that they reflect the
current status of the technology. Many
sections have been expanded, such as
the sections on fundamentals, high-
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
723
Notiziario
energy density, solid-state welding
and especially weld modelling. New
processes and process variations developed since the last printing of this
Volume have been incorporated, including friction stir welding, magnetic
pulse welding, hybrid processes, direct
metal deposition, penetration enhancing fluxes and ultrasonic additive manufacturing. A section on safe practices
has also been added.
We wish to thank our many colleagues
who served as section editors and
authors of the individual articles.
This handbook would not have been
possible without their efforts.
ASM International,
9639 Kinsman Road,
Materials Park OH 44073-0002 (USA)
www.asminternational.org
Welding and joining of aerospace
materials
Chaturvedi M. C.,
Cambridge (Inghilterra) 2011
234 x 156 mm, 448 pagine
ISBN-13: 978 1 84569 532 3, € 185,00
Questo volume fornisce un’analisi approfondita delle tecniche più recenti
ed avanzate nel settore della giunzione
dei materiali metalli e non metallici,
impiegati nell’industria delle costruzioni aerospaziali. Il testo, diviso principalmente in due parti, presenta nella
prima un capitolo introduttivo sulle
più recenti tecniche di saldatura, mentre quelli successivi si concentrano sui
diversi tipi di processi, comprendendo
la saldatura ad attrito, la saldatura laser
ed i processi ibridi laser/arco.
Il capitolo finale di questa prima parte
presenta una rassegna sull’analisi della
criccabilità della zona termicamente
alterata di saldature di superleghe di
nichel.
724
La seconda parte riguarda altre tecniche di giunzione, tra cui la rivettatura,
la giunzione con adesivi, la giunzione con adesivi di materiali dissimili
(compositi/metallici) e la brasatura
ad alta temperatura. Questa seconda
parte si conclude con un’appendice
dedicata completamente alla “linear
friction welding”. Questo volume è un
riferimento essenziale per specialisti e
progettisti nel settore delle costruzioni aerospaziali ed in special modo per
tutti coloro che hanno un particolare
interesse per la ricerca accademica nel
settore.
Welding and joining techniques play
an essential role in both the manufacture and in-service repair of aerospace structures and components, and
these techniques have become more
advanced as new, complex materials
are developed. Welding and joining of
aerospace materials provides an indepth review of different techniques
for joining metallic and non-metallic
aerospace materials.
Welding and joining techniques play
an essential role in both the manufacture and in-service repair of aerospace
structures and components, and these
techniques become more advanced as
new, complex materials are developed.
Welding and joining of aerospace materials provides an in-depth review of
different techniques for joining metallic and non-metallic aerospace materials. Part one opens with a chapter on
recently developed welding techniques
for aerospace materials. The next few
chapters focus on different types of
welding such as inertia friction, laser
and hybrid laser-arc welding.
The final chapter in part one discusses
the important issue of heat affected
zone cracking in welded superalloys.
Part two covers other joining techniques, including chapters on riveting,
composite-to-metal bonding, diffusion
bonding and recent improvements in
bonding metals. Part two concludes
with a chapter focusing on the use
of high-temperature brazing in aerospace engineering. Finally, an appendix to the book covers the important
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
issue of linear friction welding.
With its distinguished editor and international team of contributors, welding
and joining of aerospace materials is
an essential reference for engineers
and designers in the aerospace, materials and welding and joining industries, as well as companies and other
organisations operating in these sectors and all those with an academic
research interest in the subject.
Woodhead Publishing Limited,
Abington Hall, Abington, Cambridge,
CB21 6AH (Inghilterra)
Fax: +44 (0)1223 893 694
www.woodheadpublishing.com
Fatigue Design of Steel and Composite
Structures: Eurocode 3: Design of
Steel Structures, Part 1-9 Fatigue;
Eurocode 4: Design of Composite
Steel and Concrete Structures
Nussbaumer A., Borges L., Davaine L.
Coimbra (Portogallo) 2011
234 x 156 mm, 334 pagine
ISBN: 978-3-433-02981-7, € 55,00
Nella progettazione di ponti e grandi
strutture civili in acciaio la corretta valutazione della resistenza a fatica degli
elementi strutturali costituisce senza
dubbio uno degli aspetti di maggiore
rilievo. Il testo propone una trattazione particolarmente approfondita
e accurata delle procedure di verifica
attualmente in vigore, con numerosi e
puntuali riferimenti alle prescrizioni
delle norme europee citate nel titolo
(Eurocodice 3 e Eurocodice 4).
Non viene trascurata l’interazione tra
progetto e fabbricazione dei componenti, che viene affrontata con un esame dettagliato dei principali riferimenti normativi che disciplinano le fasi
esecutive ed una sintetica descrizione
dei relativi contenuti.
Notiziario
L’esame delle differenti tematiche è
corredato da numerosi e dettagliati
esempi applicativi, che vengono discussi con particolare efficacia e costituiscono un prezioso orientamento per
la corretta applicazione delle procedure di verifica. Il testo può senza dubbio essere preso in considerazione, di
conseguenza, non solo come supporto
didattico nell’ambito dei corsi universitari di Tecnica delle Costruzioni,
Costruzione di Ponti e Costruzioni in
Acciaio, ma anche come manuale applicativo per chi svolge attività professionali nell’ambito della progettazione
e/o del coordinamento delle fasi esecutive.
This volume addresses the specific subject of fatigue, a subject not familiar to
many engineers, but still relevant for
proper and good design of numerous
steel structures. It explains all issues
related to the subject: Basis of fatigue
design, reliability and various verifica-
tion formats, determination of stresses
and stress ranges, fatigue strength, application range and limitations.
It contains detailed examples of applications of the concepts, computation
methods and verifications.
ECCS-CECM-EKS
32, av. des Ombrages, bte 20 - 1200
Brussels (Belgio)
Fax: +32-2/762.09.35
www.steelconstruct.com
Codici e norme
Norme nazionali
Italia
UNI EN 13480-1 - Tubazioni industriali metalliche - Parte 1: Generalità
(2012).
CEI EN 60974-12 - Apparecchiature per la saldatura ad arco - Parte 12:
Dispositivi di collegamento per cavi di
saldatura (2012).
UNI EN 13480-2 - Tubazioni industriali metalliche - Parte 2: Materiali
(2012).
CEI EN 60974-13 - Apparecchiature
per la saldatura ad arco - Parte 13: Pinze di massa (2012).
UNI CEN ISO/TR 3834-6 - Requisiti
di qualità per la saldatura per fusione
dei materiali metallici - Parte 6: Guida per l’applicazione della ISO 3834
(2012).
UNI EN ISO 5172 - Apparecchiature
per saldatura a gas - Cannelli per saldatura a gas, riscaldo e taglio - Requisiti e prove (2012).
UNI EN ISO 9712 - Prove non distruttive - Qualificazione e certificazione
del personale addetto alle prove non
distruttive (2012).
UNI EN 12258-1 - Alluminio e leghe
di alluminio - Termini e definizioni Parte 1: Termini generali (2012).
UNI EN 12451 - Rame e leghe di rame
- Tubi tondi senza saldatura per scambiatori di calore (2012).
UNI EN 12452 - Rame e leghe di
rame - Tubi alettati senza saldatura per
scambiatori di calore (2012).
UNI EN 12999 - Apparecchi di sollevamento - Gru caricatrici (2012).
UNI EN 13480-3 - Tubazioni industriali metalliche - Parte 3: Progettazione e calcolo (2012).
UNI EN 13480-4 - Tubazioni industriali metalliche - Parte 4: Fabbricazione e installazione (2012).
UNI EN 13480-5 - Tubazioni industriali metalliche - Parte 5: Collaudo e
prove (2012).
UNI EN 13480-6 - Tubazioni industriali metalliche - Parte 6: Requisiti addizionali per tubazioni interrate
(2012).
UNI EN 13480-8 - Tubazioni industriali metalliche - Parte 8: Requisiti
addizionali per tubazioni di alluminio
e leghe di alluminio (2012).
UNI EN ISO 13585 - Brasatura forte - Qualificazione dei brasatori e degli
operatori per la brasatura forte (2012).
UNI CEN ISO/TS 15011-6 - Salute e
sicurezza nella saldatura e nelle tecniche affini - Metodo di laboratorio per
il campionamento dei fumi e dei gas
- Parte 6: Procedura per la determinazione quantitativa dei fumi e dei gas
generati dalla saldatura a resistenza a
punti (2012).
UNI CEN/TR 15135 - Saldatura Progettazione e prove non distruttive
di saldature (2012).
UNI CEN/TR 15235 - Saldatura - Metodi per la valutazione delle imperfezioni nelle strutture metalliche (2012).
UNI CEN ISO/TR 15608 - Saldatura - Guida per un sistema di suddivisione in gruppi dei materiali metallici
(2012).
UNI EN ISO 15614-13 - Specificazione e qualificazione delle procedure di
saldatura per materiali metallici - Prove di qualificazione della procedura di
saldatura - Parte 13: Saldatura a resistenza testa a testa e a scintillio (2012).
UNI CEN/TR 14599 - Termini e definizioni per la saldatura in relazione
alla EN 1792 (2012).
UNI CEN ISO/TR 17641-3 - Prove
distruttive su saldature di materiali
metallici - Prove di criccabilità a caldo
di elementi saldati - Processi di saldatura ad arco - Parte 3: Prove sottoposte
ad un carico esterno (2012).
UNI CEN/TR 14633 - Saldatura - Posizioni di saldatura - Comparazione tra
le designazioni internazionali, europee
e americane (2012).
UNI CEN ISO/TR 17844 - Saldatura - Confronto tra i metodi normalizzati per evitare le cricche a freddo
(2012).
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
725
Notiziario
Norme americane
USA
ASTM A182/A182M - Standard specification for forged or rolled alloy and
stainless steel pipe flanges, forged fittings, and valves and parts for hightemperature service (2012).
ASTM A203/A203M - Standard specification for pressure vessel plates, alloy steel, nickel (2012).
ASTM A204/A204M - Standard specification for pressure vessel plates, alloy steel, molybdenum (2012).
ASTM A225/A225M - Standard specification for pressure vessel plates, alloy steel, manganese-vanadium-nickel
(2012).
ASTM A285/A285M - Standard specification for pressure vessel plates, carbon steel, low and intermediate tensile
strength (2012).
ASTM A302/A302M - Standard specification for pressure vessel plates,
alloy steel, manganese-molybdenum
and manganese-molybdenum-nickel
(2012).
ASTM A455/A455M - Standard specification for pressure vessel plates,
carbon steel, high-strength manganese
(2012).
ASTM A513/A513M - Standard specification for electric-resistance-welded
carbon and alloy steel mechanical tubing (2012).
ASTM A612/A612M - Standard specification for pressure vessel plates, carbon steel, high strength, for moderate
and lower temperature service (2012).
ASTM A662/A662M - Standard specification for pressure vessel plates,
carbon-manganese-silicon steel, for
moderate and lower temperature service (2012).
ASTM A703/A703M - Standard
specification for steel castings, general
requirements, for pressure-containing
parts (2012).
726
ASTM A734/A734M - Standard specification for pressure vessel plates, alloy steel and high-strength low-alloy
steel, quenched-and-tempered (2012).
ASTM A735/A735M - Standard specification for pressure vessel plates,
low-carbon manganese-molybdenumcolumbium alloy steel, for moderate
and lower temperature service (2012).
ASTM A738/A738M - Standard specification for pressure vessel plates,
heat-treated, carbon-manganese-silicon steel, for moderate and lower temperature service (2012).
ASTM A970/A970M - Standard specification for headed steel bars for concrete reinforcement (2012).
AWS D9.1M/D9.1 - Sheet metal welding code (2012).
Norme europee
EN
EN ISO 12212 - Petroleum, petrochemical and natural gas industries Hairpin-type heat exchangers (2012).
Norme internazionali
ISO
ISO 4965-1 - Metallic materials - Dynamic force calibration for uniaxial fatigue testing - Part 1: Testing systems
(2012).
ISO 4965-2 - Metallic materials - Dynamic force calibration for uniaxial
fatigue testing - Part 2: Dynamic calibration device (DCD) instrumentation
(2012).
ISO 6363-1 - Wrought aluminium and
aluminium alloys - Cold-drawn rods/
bars, tubes and wires - Part 1: Technical conditions for inspection and delivery (2012).
ISO 6363-2 - Wrought aluminium and
aluminium alloys - Cold-drawn rods/
bars and tubes and wires - Part 2: Mechanical properties (2012).
ISO 6363-3 - Wrought aluminium and
aluminium alloys - Cold-drawn rods/
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
bars, tubes and wires - Part 3: Drawn
round bars and wires - Tolerances on
form and dimensions (symmetric plus
and minus tolerances on diameter)
(2012).
ISO 6363-4 - Wrought aluminium and
aluminium alloys - Cold-drawn rods/
bars, tubes and wires - Part 4: Drawn
rectangular bars and wires - Tolerances
on form and dimensions (2012).
ISO 6363-5 - Wrought aluminium and
aluminium alloys - Cold-drawn rods/
bars, tubes and wires - Part 5: Drawn
square and hexagonal bars and wires
- Tolerances on form and dimensions
(2012).
ISO 6363-6 - Wrought aluminium and
aluminium alloys - Cold-drawn rods/
bars, tubes and wires - Part 6: Drawn
round tubes - Tolerances on form and
dimensions (2012).
ISO 7866 - Gas cylinders - Refillable
seamless aluminium alloy gas cylinders - Design, construction and testing
(2012).
ISO 9606-1 - Qualification testing
of welders - Fusion welding - Part 1:
Steels (2012).
ISO 11119-1 - Gas cylinders - Refillable composite gas cylinders and tubes
- Design, construction and testing Part 1: Hoop wrapped fibre reinforced
composite gas cylinders and tubes up
to 450 l (2012).
ISO 12107 - Metallic materials - Fatigue testing - Statistical planning and
analysis of data (2012).
ISO 12108 - Metallic materials - Fatigue testing - Fatigue crack growth
method (2012).
ISO 14802 - Corrosion of metals and
alloys - Guidelines for applying statistics to analysis of corrosion data
(2012).
ISO 16162 - Cold-rolled steel sheet
products - Dimensional and shape tolerances (2012).
Notiziario
.
Istituto Italiano della Saldatura Divisione Formazione
Lungobisagno Istria 15 16141 Genova
www.formazionesaldatura.it
[email protected]
.
Corsi IIS
Luogo
Data
Titolo
Ore
Legnano
19-20/11/2012
Corso per Auditor / Lead Auditor - Modulo Base ISO 19011
24
Genova
19-23/11/2012
Corso per International Welding Engineer (IWE) - Parte 3 - Modulo
Metallurgia e saldabilità
--
Genova
19-23/11/2012
Corso per International Welding Technologist (IWT) - Parte 3 - Modulo
Metallurgia e saldabilità
--
Genova
19-23/11/2012
Corso sulla saldatura robotizzata - Corso di qualificazione per European
Robot Welding Specialist
--
Genova
19-23/11/2012
Corso sulla microsaldatura in elettronica - Corso per la certificazione in
accordo alla specifica ECSS-Q-ST-70-38, Operatore (CAT. 3)
36
Genova
19-23/11/2012
Corso sulla microsaldatura in elettronica - Corso per la certificazione in
accordo alla specifica ECSS-Q-ST-70-38, Ispettore (CAT. 2)
36
Legnano
21-23/11/2012
Corso per Auditor / Lead Auditor Qualità ISO 9001
24
Genova
21-23/11/2012
Corso sulla microsaldatura in elettronica - Corso per la certificazione in
accordo alla specifica ECSS-Q-ST-70-38, Operatore (CAT. 3)
24
Genova
21-23/11/2012
Corso sulla microsaldatura in elettronica - Corso per la certificazione in
accordo alla specifica ECSS-Q-ST-70-38, Ispettore (CAT. 2)
24
Genova
26-28/11/2012
Corso sulla saldatura dei tondi per cemento armato - Livello Specialist Modulo Base
20
Genova
26-29/11/2012
Corso sulla tecnologia Laser - Modulo integrativo pratico per livello Basic
--
Legnano
26-30/11/2012
Corso per International Welding Engineer (IWE) - Parte 3 - Modulo
Metallurgia e saldabilità
--
Legnano
26-30/11/2012
Corso per International Welding Technologist (IWT) - Parte 3 - Modulo
Metallurgia e saldabilità
--
Genova
26-30/11/2012
Corso celere in saldatura
32
Genova
27-28/11/2012
Corso sulla microsaldatura in elettronica - Corso per la ricertificazione in
accordo alla specifica ECSS-Q-ST-70-08, Operatore (CAT. 3) e/o Ispettore
(CAT. 2)
16
Genova
27-29/11/2012
Corso sull’applicazione del DM 14 Gennaio 2008 - Corso per progettisti e
Direttori dei lavori
20
Genova
28-30/11/2012
Corso sulla saldatura dei tondi per cemento armato - Livello Specialist Modulo saldatura di tondini per cemento armato
20
Genova
29-30/11/2012
Corso sulla microsaldatura in elettronica - Corso per la ricertificazione in
accordo alla specifica ECSS-Q-ST-70-38, Operatore (CAT. 3) e/o Ispettore
(CAT. 2)
16
Genova
03-04/12/2012
Corso per International Welding Pratictioner (IWP) - Parte 3 - Modulo
Tecnologia della Saldatura
--
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
727
Notiziario
728
Luogo
Data
Titolo
Genova
03-05/12/2012
Corso per International Welding Engineer (IWE) - Parte 3 - Modulo
Progettazione e calcolo
--
Genova
03-05/12/2012
Corso sulla gestione del processo di fabbricazione mediante saldatura
(EN ISO 3834)
20
Genova
04-06/12/2012
Corso per International Welding Pratictioner (IWP) - Parte 3 - Modulo
Metallurgia e saldabilità
--
Genova
05-07/12/2012
Corso per International Welding Engineer (IWE) - Parte 3 - Modulo
Fabbricazione
--
Genova
06-07/12/2012
Corso per International Welding Pratictioner (IWP) - Parte 3 - Modulo
Progettazione e calcolo
--
Genova
06-07/12/2012
Corso sulla gestione del processo di fabbricazione mediante saldatura Modulo integrativo Auditor EN ISO 3834
16
Genova
06-07/12/2012
Genova
10-11/12/2012
Genova
10-12/12/2012
Corso per International Welding Engineer (IWE) - Parte 3 - Modulo
Tecnologia della Saldatura
--
Legnano
10-12/12/2012
Corso per International Welding Engineer (IWE) - Parte 3 - Modulo
Metallurgia e saldabilità
--
Genova
11/12/2012
Corso sulla microsaldatura in elettronica - Corso per la ricertificazione in
accordo alla specifica ECSS-Q-ST-70-26, Operatore (CAT. 3) e/o Ispettore
(CAT. 2)
8
Genova
11-13/12/2012
Corso per Auditor / Lead Auditor Sicurezza OHSAS 18001
24
Genova
12/12/2012
Genova
12/12/2012
Genova
12-14/12/2012
Genova
13-14/12/2012
Genova
13-14/12/2012
Genova
18-19/12/2012
Gestione ambientale nella fabbricazione mediante saldatura
16
Genova
07-11/01/2013
Corso per International Welding Pratictioner (IWP) - Parte 3 - Modulo
Fabbricazione
--
Genova
14-18/01/2013
Corso per International Welding Engineer (IWE) - Parte 3 - Modulo
Progettazione e calcolo
--
Genova
14-18/01/2013
Corso per International Welding Technologist (IWT) - Parte 3 - Modulo
Progettazione e calcolo
--
Mogliano Veneto
21-25/01/2013
Corso per International Welding Technologist (IWT) - Parte 3 - Modulo
Progettazione e calcolo
--
Genova
28-01/02/2013
Corso per International Welding Specialist (IWS) - Parte 3 - Modulo
Tecnologia della saldatura
--
Corso sulla microsaldatura in elettronica - Corso per la ricertificazione in
accordo alla specifica ECSS-Q-ST-70-28, Operatore (CAT. 3) e/o Ispettore
(CAT. 2)
Corso sulla microsaldatura in elettronica - Corso per la certificazione in
accordo alla specifica ECSS-Q-ST-70-26, Operatore (CAT. 3) e/o Ispettore
(CAT. 2)
Corso sulla microsaldatura in elettronica - Corso per la certificazione in
accordo alla specifica ECSS-Q-ST-70-30, Operatore (CAT. 3) e/o Ispettore
(CAT. 2)
Corso sulla microsaldatura in elettronica - Corso per la ricertificazione in
accordo alla specifica ECSS-Q-ST-70-30, Operatore (CAT. 3) e/o Ispettore
(CAT. 2)
Corso per International Welding Engineer (IWE) - Parte 3 - Modulo
Metallurgia e saldabilità
Corso sulla microsaldatura in elettronica - Corso per la certificazione in
accordo alla specifica ECSS-Q-ST-70-18, Operatore (CAT. 3) e/o Ispettore
(CAT. 2)
Corso sulla microsaldatura in elettronica - Corso per la ricertificazione in
accordo alla specifica ECSS-Q-ST-70-18, Operatore (CAT. 3) e/o Ispettore
(CAT. 2)
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
Ore
16
12
8
8
-12
8
Notiziario
Corsi IIS di qualificazione per personale addetto alle PND di livello 1, 2 e 3
Luogo
Data
Modulo Base (MB)
Ore
Priolo
20-21/11/2012
Modulo di Base per livello 2 EN 473, ISO 9712, ASNT SNT-TC-1A
16
Genova
20-21/11/2012
Modulo di Base per livello 2 EN 473, ISO 9712, ASNT SNT-TC-1A
16
Luogo
Data
Esame Visivo (VT)
Genova
22/11/2012
Modulo di Metodo (MM) per livello 2 EN 473, ISO 9712
8
Priolo
22/11/2012
Modulo di Metodo (MM) per livello 2 EN 473, ISO 9712
8
Genova
29-30/11/2012
Modulo Specifico (MS) Saldatura per livello 2 EN 473, ISO 9712
12
Priolo
29-30/11/2012
Modulo Specifico (MS) Corrosione e verniciatura
12
Luogo
Data
Esame Radiografico (RT)
Genova
11-14/12/2012
Modulo di Metodo (MM) per livello 2 EN 473, ISO 9712
Luogo
Data
Esame Ultrasonoro (UT)
Genova
19-23/11/2012
Modulo Specifico (MS) Operatore Tecniche Convenzionali
36
Mogliano Veneto
26-30/11/2012
Modulo Specifico (MS) Operatore Tecniche Convenzionali
36
Luogo
Data
Esame con Particelle Magnetiche (MT)
Legnano
03-04/12/2012
Modulo di Metodo (MM) per livello 2 EN 473, ISO 9712
16
Mogliano Veneto
11-12/12/2012
Modulo di Metodo (MM) per livello 2 EN 473, ISO 9712
16
Luogo
Data
Esame con Liquidi Penetranti (PT)
Legnano
05-06/12/2012
Modulo di Metodo (MM) per livello 2 EN 473, ISO 9712
16
Mogliano Veneto
13-14/12/2012
Modulo di Metodo (MM) per livello 2 EN 473, ISO 9712
16
Ore
Ore
28
Ore
Ore
Ore
Corsi IIS di specializzazione nelle imperfezioni di saldatura per personale addetto alle PND
Genova
27-29/11/2012
Corso di specializzazione nelle imperfezioni di saldatura per personale
addetto alle PND
24
Corsi di altre Società
Luogo
Data
Titolo
Organizzatore
Roma
15-28/11/2012
Valutatori Sistemi di Gestione della Sicurezza
AICQ - Centro Insulare
www.aicqci.it
Roma
19-21/11/2012
Corso di Qualificazione per Mystery Auditor: la
norma UNI/TS 11312:2008
AICQ - Centro Insulare
www.aicqci.it
Roma
19-21/11/2012
Auditor / Responsabili Gruppo di Audit Interni di
Sistemi di Gestione per la Qualità
ANGQ
www.angq.com
Roma
19-23/11/2012
Auditor / Responsabili Gruppo di Audit di Sistemi di
Gestione per la Qualità
ANGQ
www.angq.com
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
729
Notiziario
730
Notiziario
Luogo
Data
Titolo
Organizzatore
Milano
20/11/2012
La valutazione dell’incertezza di misura
UNI
www.uni.com
Torino
20-22/11/2012
Auditor / Responsabili Gruppo di Audit di Sistema di
gestione Qualità - Modulo specialistico
CERMET
www.cermet.it
Roma
26/11/2012
Organizzazioni di successo - UNI EN ISO 9004:2009
UNI
www.uni.com
Milano
26-28/11/2012
Auditor / Responsabili Gruppo di Audit di Sistema di
gestione della Safety - Modulo specialistico
CERMET
www.cermet.it
Milano
28/11/2012
La nuova norma UNI CEI EN ISO/IEC 17020:2012.
Valutazione della conformità: requisiti per il funzionamento dei vari tipi di organismi che effettuano attività di ispezione
UNI
www.uni.com
Milano
29/11/2012
Gestire l’organizzazione per processi: persone,
attività, tempi e costi
UNI
www.uni.com
Roma
29-30/11/2012
Auditor / Responsabili Gruppo di Audit
CERMET
www.cermet.it
Roma
29-30/11/2012
L’approccio per processi e la redazione della documentazione del Sistema di Gestione per la Qualità:
Manuale Qualità e Procedure
ANGQ
www.angq.com
Roma
29-30/11/2012
La taratura e la conferma metrologica delle apparecchiature di misura
UNI
www.uni.com
Milano
03/12/2012
Organizzazioni di successo - UNI EN ISO 9004:2009
UNI
www.uni.com
Roma
03/12/2012
Il miglioramento delle prestazioni di
un’organizzazione: indicatori e strumenti
ANGQ
www.angq.com
Roma
03-05/12/2012
La norma UNI EN ISO 9001:2008 e i Sistemi di
Gestione per la Qualità
AICQ - Centro Insulare
www.aicqci.it
Roma
06/12/2012
Controllo statistico del processo
ANGQ
www.angq.com
Roma
07/12/2012
Processi affidati all’esterno: un’opportunità di miglioramento della partnership
ANGQ
www.angq.com
Roma
07/12/2012
La nuova norma UNI EN ISO 19011:2012 - Linee
guida per gli audit dei sistemi di gestione
UNI
www.uni.com
Roma
10/12/2012
Audit interni sui Sistemi di gestione: La norma UNI
EN ISO 19011:2003 e le tecniche di Auditing
AICQ - Centro Insulare
www.aicqci.it
Roma
10-12/12/2012
Auditor/Responsabili Gruppo di Audit di Sistema di
gestione Qualità - Modulo specialistico
CERMET
www.cermet.it
Bologna
10-12/12/2012
Auditor / Responsabili Gruppo di Audit di Sistema di
gestione della Safety - Modulo specialistico
CERMET
www.cermet.it
Roma
11/12/2012
Gestione in qualità della progettazione
Roma
11-12/12/2012
Audit interni di Sistemi di Gestione per la Qualità
Roma
12/12/2012
I Piani di Controllo della Qualità: predisposizione,
gestione ed utilizzo
ANGQ
www.angq.com
Roma
13-14/12/2012
Corso Auditor Sistemi di Gestione per la Qualità
AICQ - Centro Insulare
www.aicqci.it
Roma
14/12/2012
La misurazione della soddisfazione del cliente: processi e tecniche di supporto
ANGQ
www.angq.com
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
ANGQ
www.angq.com
AICQ - Centro Insulare
www.aicqci.it
Notiziario
Mostre e Convegni
Luogo
Data
Titolo
Contatti
Boston, MA
25–30/11/2012
2012 MRS Fall Meeting & Exhibit
http://mrs.org/fall2012
[email protected]
Centro Congressi
FAST - Milano
Italy
27/11/2012
Convegno “Robotica ed automazione
dei processi in saldatura: quali alternative ai processi convenzionali?”
www.iis.it
[email protected]
Düsseldorf,
Germany
27-29/11/2012
Valve World Conference & Expo 2012
8th Biennal Valve World Conference
and Exhibition
www.valveworldexpo.com
[email protected]
Marina Bay Sands,
Singapore
27-30/11/2012
OSEA 2012 - Asian Oil & Gas event
www.osea-asia.com
Okinawa, Japan
27-30/11/2012
21st International Acoustic Emission
Symposium (IAES-21)
http://iaes21.org
[email protected]
Mulhouse, Francia
28-29/11/2012
Espace Laser 2012, salon des procédés
de fabrication innovants
www.espace-laser.biz
[email protected]
Indian Institute of
Technology Bombay
Mumbai, India
01/12/2012
ASME 2012 Gas Turbine India
Conference
http://calendar.asme.org
[email protected]
Beijing, China
02-05/12/2012
International Conference on
Nanojoining and Microjoining
(NMJ 2012)
www.nmj2012.com
[email protected]
Ekaterinbourg,
Russia
04-06/12/2012
Welding, Monitoring and Diagnostics
(Testing) 2012
http://eng.uv2000.ru
[email protected]
Hurghada, Egypt
10–13/12/2012
International Conference on Corrosion
Mitigation and Surface Protection
Technologies
www.egy-corr.org
[email protected]
San Jose´, Costa
Rica
11–13/12/2012
Symposium on Advanced Materials
Science and Technology
www.cicima.ucr.ac.cr/simposios
[email protected]
Lulea University
of Technology,
Sweden
12-14/12/2012
2nd International Workshop and
Congress on Maintenance
www.emaintenance2012.org
[email protected]
Beijing, China
20-21/12/2012
International Conference on Advanced
Material and Manufacturing Science
(ICAMMS 2012).
www.icamms-conf.org
[email protected]
Galveston, Texas
07–10/01/2013
2013 Inspection Summit
www.api.org
[email protected]
Dubai, Emirati
Arabi
07–10/01/2013
Arabia Essen Welding & Cutting
www.messe-duesseldorf.com
[email protected]
Orlando, FL
17–18/01/2013
3rd Annual NACE Nuclear Power
Plant Coatings Symposium
http://events.nace.org/conferences
[email protected]
Orlando, FL
19–31/01/2013
COMPOSITES 2013
www.compositesshow.org
[email protected]
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
731
Gli occhi
del padre,
la bocca
della madre.
Il sorriso lo può
ereditare da te.
C o n u n T e s t a m e n t o p e r l ’ U N I C E F.
Per i bambini più poveri del mondo la vita dipende da un vaccino, da acqua sicura, dalla
possibilità di andare a scuola e di essere protetti da abusi e sfruttamento. Con un lascito
all’UNICEF puoi dare loro tutto questo. Scopri come, richiedendo l’opuscolo informativo.
Con il patrocinio
e la collaborazione del
Consiglio Nazionale del Notariato
Invia questo coupon
in busta chiusa
o per fax a
COMITATO ITALIANO
PER L’UNICEF - ONLUS
VIA PALESTRO, 68
00185 ROMA
TEL. E FAX: 0647809263
www.unicef.it/lasciti
Voglio ricevere gratuitamente l’opuscolo informativo su come fare testamento per l’UNICEF
NOME
COGNOME
VIA
CITTÀ
N°
PROV.
CAP
TEL.
INFORMATIVA SULLA PRIVACY - I dati personali saranno trattati da Comitato Italiano per l’UNICEF Onlus - titolare del trattamento - Via Palestro 68, 00185 Roma (RM) per l’invio di
materiale informativo sui lasciti testamentari a favore dell’UNICEF. Inoltre, previo consenso, i dati saranno trattati per informare su iniziative e progetti, per campagne di raccolta fondi e
sondaggi. I dati saranno trattati, manualmente ed elettronicamente, esclusivamente dall’UNICEF e dai responsabili preposti a servizi connessi a quanto sopra; non saranno comunicati
né diffusi e saranno sottoposti a idonee procedure di sicurezza. Gli incaricati del trattamento sono gli addetti a gestire i rapporti con i sostenitori effettivi o potenziali ed i sistemi
informativi, al call center, all’organizzazione campagne di raccolta fondi, alla preparazione e invio materiale informativo. Ai sensi dell’art. 7, d. lgs 196/2003, si possono esercitare i relativi
diritti fra cui consultare, modificare, cancellare i dati od opporsi al loro trattamento per fini di invio di materiale informativo rivolgendosi al titolare al suddetto indirizzo, presso cui è
disponibile elenco dei responsabili del trattamento.
Letta l’informativa, acconsento a ricevere informazioni su progetti UNICEF SÌ
NO
Dati IIS-Data
“Saldatura al plasma” (2000-2011)
Application and optimisation of the plasma-arc welding process with a powder filler metal in the case of
the manufacture of joints on X6CrNiMoTi17-12-2, di
CHRUSZEZ M. et al., «Schweissen und Schneiden» Gennaio 2000 pp. E17-E20.
Acciai inossidabili austenitici; materiali d'apporto; microstruttura; ottimizzazione; polvere; saldatura al plasma.
Variable polarity plasma arc welding of 6.35 mm aluminium alloys: parameter development and preliminary
analysis di WOODWARD N. J. et al., «Science and Technology of W and J» Gennaio-Febbraio 2000 pp. 21-25.
Leghe Al-Cu; leghe Al-Mg-Si; leghe d'alluminio; ottimizzazione; parametri di processo; polarità; saldatura a foro di
chiave; saldatura al plasma.
Alu-Plasmaschweissen: Gleich-oder Wechselstrom?
(Soudage plasma de l'aluminium en courant continu ou
alternatif) di DZELNITZKI D., «Technica/Soudure» N. 10
2000 pp. 44-53.
Alluminio; condizioni di processo; confronti; saldatura al
plasma; saldatura TIG.
Expanding the range of application of the plasma-powder process in welding and surfacing (Svar. Proiz., N.
4/2000, pp. 28-30) di BAD'YANOV B. N. et al., «Welding
International» Settembre 2000 pp. 734-736.
Applicazioni; polvere; ricarica al plasma; saldatura al plasma.
Technology of hardering rolling rolls by microplasma
welding (Svar. Proiz., N. 6/2000, pp. 35-40) di SHAPARENKO A. V., «Welding International» Novembre 2000 pp.
913-917.
Indurimento; indurimento superficiale; laminazione; microgiunzione; saldatura al plasma.
Un'azione combinata di fascio laser e arco plasma di
VERTEMATI A., «Deformazione» N. 71/2000 pp. 186-190.
Parametri di processo; procedimenti combinati; saldatura
al plasma; saldatura laser.
Process control based on double-side image sensing of
keyhole puddle for the VPPA welding of aluminium alloys di ZHONGHUA L. et al., «China Welding» LuglioDicembre 2000 pp. 143-151.
Comando a retroazione; intelligenza artificiale; leghe d'alluminio; parametri di processo; saldatura a foro di chiave;
saldatura al plasma; simulazione; sistemi di controllo; sistemi intelligenti.
Control for weld penetration in VPPAW of aluminum alloys using the front weld pool image signal di ZHENG
B. et al., «Welding Journal» Dicembre 2000 pp. 363s-371s.
Bagno di fusione; intelligenza artificiale; leghe d'alluminio;
operazioni in tempo reale; penetrazione; saldatura a foro
di chiave; saldatura al plasma; sistemi di controllo; sistemi
intelligenti.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
733
5LFHUFKH%LEOLRJUDÀFKH
Plasmaschweißen von Aluminiumlegierungen mit Pluspolung in hohen Leistungsbereichen (Plasma arc welding
of aluminium alloys with reverse polarity in high power
ranges) di DILTHEY U. e KABATNIK L., «Schweissen
und Schneiden» Marzo 2001 pp. 156-161.
Flange; giunti a sovrapposizione; giunti testa a testa; leghe Al-Mg; leghe d'alluminio; metallografia; parametri di
processo; polarità; saldatura a foro di chiave; saldatura al
plasma.
Plasma welding (Review)
di GVOZDETSKY V. S. e MAKARENKO N. A., «The Paton Welding Journal» Dicembre 2000 pp. 24-28.
Apparecchiature; centrali elettriche; costruzioni elettriche;
costruzioni navali; industria automobilistica; microgiunzione; recensione, rassegna; saldatura al plasma.
Producing of combined components with permanent
joints using plasma arc remelting of charge di LATASH
YU. V. et al., «The Paton Welding Journal» Dicembre 2000
pp. 67-70.
Composizione chimica; cromo; fusione; materiali dissimili;
saldatura al plasma.
Plasma arc torch with an oxide cathode di LAKOMSKY
V. I., «The Paton Welding Journal» Dicembre 2000 pp. 70-74.
Arco elettrico; catodo; ossidi; plasma; progettazione, concezione; ricarica al plasma; saldatura al plasma; spruzzatura al plasma; torce.
Noncontact acoustic analysis monitoring of plasma arc
welding di WANG Y. e ZHAO P., «The International Journal
of PVP» V. 78, N.1/2001 pp. 43-47 .
Acciai inossidabili; altri metodi di controllo non distruttivo;
bagno di fusione; emissione acustica; saldatura a foro di
chiave; saldatura al plasma; sistemi di controllo.
Efflux plasma charge-based sensing and control of
joint penetration during keyhole plasma arc welding di
ZHANG S. B. e ZHANG Y. M., «Welding Journal» Luglio
2001 pp. 157s-162s.
Comando a retroazione; penetrazione; preparazione dei
giunti; saldatura a foro di chiave; saldatura al plasma; sensori.
Flexible Prozessführung fördert das Plasmaschweissen
(La conduite flexible du processus favorise le développement du soudage plasma) di UNDI T., «Technica/Soudure» N. 20/2001 pp. 46-50.
Apparecchiature; saldatura al plasma; serbatoi di stoccaggio.
Minimal deformation and internal stress in the production of geometrically complex components using
contour-building powder layer pulse plasma welding di
734
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
MATTHES K-J. e ALALUSS K., «Joining of Materials»
Ottobre-Dicembre 2001 pp. 102-106.
Condizioni di processo; deformazione; metallo depositato;
parametri di processo; polvere; ricarica al plasma; saldatura ad arco ad impulsi; saldatura al plasma.
Hybrid laser-microplasma welding of thin sections of
metals di PATON B. E. et al., «The Paton Welding Journal»
Marzo 2002 pp. 2-6.
Apparecchiature; leghe Al-Mg; leghe d'alluminio; microgiunzione; parametri di processo; penetrazione; procedimenti combinati; saldatura al plasma; saldatura laser.
A system for mechanized microplasma welding of honeycomb aluminium metal structures di PATON V. E. et al.,
«The Paton Welding Journal» Marzo 2002 pp. 32-36.
Alluminio; apparecchiature; generatori di corrente per saldatura; meccanizzazione; microgiunzione; saldatura al plasma; strutture a nido d'api.
Effect of polarity on the heat input into the nozzle of a
plasma torch di SHCHITSYNV V. e YUYAZOVSKIKH
M. «Welding International» Giugno 2002 pp. 485-487.
Apporto termico specifico; corrente elettrica; fattori di influenza; parametri di processo; polarità; saldatura al plasma; torce; ugelli.
Enhanced methods of heat sources in welding and plasma spraying (1st Report) - Overview of simple thermal
plasma models di RONDA J. et al., «Transactions of JWRI»
Gennaio-Giugno 2002 pp. 1-11.
Condizioni di processo; flusso termico; generatori di corrente per saldatura; parametri di processo; proprietà fisiche; ricarica al plasma; saldatura al plasma; saldatura
TIG; simulazione.
Enhanced models of heat sources in welding and plasma
spraying (2nd Report) - Examples of thermal plasma
models di RONDA J. et al., «Transactions of JWRI» LuglioDicembre 2002 pp. 107-128.
Bilancio energetico; calcolo; fisica dell'arco; generatori di
corrente per saldatura; plasma; proprietà termiche; saldatura al plasma; saldatura TIG; simulazione; spruzzatura al
plasma.
Novel method of cooling plasma welding torch head di
WU P. S. et al., «Science and Technology of W and J» Luglio-Agosto 2002 pp. 247-252.
Distribuzione della temperatura; progettazione, concezione;
raffreddamento; saldatura al plasma; torce.
Wirtschaftlich Beschichten mit Plasma (Plaquage économique grâce au plasma) di SZIESLO U., «Technica/Soudure» N. 10 2003 pp. 76-80.
Apparecchiature; Economia; Placcatura; Saldatura al plasma.
5LFHUFKH%LEOLRJUDÀFKH
Plasma arc welding of the superalloys Inconel 625 and
718: parameter areas and mechanical properties di CASTRO M. B. G. et al., «Joining of Materials» N. 1/2 2003 pp.
1-8.
Corrente elettrica; durezza; fattori di influenza; gas di protezione; gas-plasma; Inconel; parametri di processo; procedura di processo; proprietà meccaniche; prove di piegamento; prove di trazione; saldatura a foro di chiave; saldatura
al plasma; supporto al rovescio; velocità.
parametri di processo; polarità; rame; saldatura al plasma;
tubi; tungsteno.
Plasma welding of aluminium alloys di SHCHITSYN YU
D. «Welding International» Ottobre 2003 pp. 825-832.
Automazione; leghe Al-Mg; leghe d'alluminio; microstruttura; ricarica al plasma; riparazione; saldatura al plasma.
Saldatura strutturale di tubi di elevato spessore con tecnica PAW keyhole e finitura con polveri di MARCONI M.
e MARCONI B., «Rivista Italiana della Saldatura» Novembre-Dicembre 2004 pp. 813-830.
Acciai ad alta lega; alta temperatura; grosso; pezzi fusi;
polvere; saldatura a foro di chiave; saldatura al plasma;
spessore; tubi.
Effect of process parameters of micro-plasma arc welding on morphology and quality in stainless steel edge
joint welds di TSENG K. H. et al., «Science and Technology of W and J» Novembre-Dicembre 2003 pp. 423-430.
Acciai inossidabili austenitici; confronti; corrente elettrica;
forma della saldatura; gas di protezione; microgiunzione;
parametri di processo; qualità; saldatura al plasma; saldatura TIG; velocità.
Optimisation of gas shielding in plasma welding di
SHARAPOV M. G., «Welding International» Novembre
2003 pp. 886-889.
Calcolo; flusso; gas di protezione; ottimizzazione; saldatura
al plasma; torce.
Cathodic cleaning in variable polarity plasma arc welding of aluminum alloys di KEXUAN C. et al., «China
Welding» Luglio-Dicembre 2003 pp. 168-170.
Leghe d'alluminio; parametri di processo; polarità; preparazione superficiale; saldatura al plasma.
Pulsed plasma arc cladding di JINGLONG L. et al., «China Welding» Gennaio-Giugno 2004 pp. 7-10.
Generatori di corrente per saldatura; placcatura; saldatura
ad arco ad impulsi; saldatura al plasma; saldatura al plasma con arco trasferito.
Development of a tungsten cathode for microplasma
welding of components with reversed polarity current di
AN'SHAKOV A. S. et al., «Welding International» Agosto
2004 pp. 641-645.
Alluminio; catodo; controllo automatico; corrente elettrica; microgiunzione; microstruttura; operazione manuale;
Generalization of formula of K. K. Khrenov for determination of temperature of welding arc plasma di PENTEGOV I. V., «The Paton Welding Journal» Agosto 2004
pp. 48-50.
Calcolo; distribuzione della temperatura; misura; modelli
di calcolo; pressione; saldatura al plasma; temperatura.
Auf Schweissgas und zusatzwerkstoff kommt es an
(L'importance du gaz de soudage et du matériau d'apport) di GÖBEL M., «Technica/Soudure» N. 1-2 2005 pp.
47-48.
Fattori di influenza; gas; gas di protezione; materiali d'apporto; saldatura al plasma.
Verificação do efeito das principais variáveis do processo
a plasma e modelagem da geometria de... (Verification of
the effect of the principal plasma process variables and
weld bead geometry modelling for keyhole welding of
stainless steel 304L) di RICHETTI A. et al., «Soldagem &
Inspecao» Marzo 2004 pp. 129-135.
Acciai inossidabili austenitici; corrente elettrica; fattori di
influenza; forma della saldatura; parametri di processo;
saldatura a foro di chiave; saldatura al plasma; simulazione; varianti dei procedimenti; velocità.
Improving the energy efficiency of plasma welding di
REDCHITS A. V. et al., «Welding International» Gennaio
2005 pp. 62-64.
Produttività; saldatura al plasma.
Manual keyhole plasma arc welding with application
(AISI 316) di LI X. R. et al., «Welding Journal» Dicembre
2011 pp. 258s-264s.
Acciai inossidabili; acciai inossidabili austenitici; controllo
non distruttivo; controllo visivo; corrente elettrica; modelli
di calcolo; parametri di processo; penetrazione; radiografia; saldatura al plasma; tensione elettrica; tubi.
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
735
5LFHUFKH%LEOLRJUDÀFKH
736
Rivista Italiana della Saldatura - n. 5 - Settembre / Ottobre 2012
Elenco
degli
Inserzionisti
-605-606
-------626
-626+682
----716
589
-650
--4a di copertina
------------------618
-717
-708
737
----692
-604
-----661
700
---
722
710
---603
------709
-594
691
----------625
---696
640
639
ACS ACAI
AEC TECHNOLOGY
AIPND
AIR LIQUIDE WELDING
ANASTA
ANDIT AUTOMAZIONE
AQM
ASG Superconductors
ASSOMOTORACING
BERKENHOFF
BIT
BÖHLER WELDING GROUP ITALIA
CAPILLA
CEA
CEBORA
CGM TECHNOLOGY
COM-MEDIA
COMMERSALD
DRAHTZUG STEIN
DVC - DELVIGO COMMERCIALE
EDIBIT
EDIMET
ESAB SALDATURA
ESARC
ETC OERLIKON
EUROCONTROL
F.B.I.
FIERA ACCADUEO
FIERA AFFIDABILITA’ & TECNOLOGIE
FIERA AIRET
FIERA BIAS
FIERA BIMEC
FIERA BI-MU
FIERA BIMU-MED
FIERA DI ESSEN
FIERA EUROBLECH
FIERA EXPOLASER
FIERA EXPOMECCANICA
FIERA LAMIERA
FIERA LASER WORLD OF PHOTONICS
FIERA MCM
FIERA MECSPE
FIERA METEF
FIERA MOTORSPORT EXPOTECH
FIERA SAMUMETAL
FIERA SEATEC
FIERA SEP
FIERA TEKNOMOTIVE
FIERA TT EXPO
FIERA VENMEC
FONDAZIONE ALDINI VALERIANI
FRO-AIR LIQUIDE Welding Italia
GE INSPECTION TECHNOLOGIES
GILARDONI
HARMS & WENDE
HENKEL ITALIA
HYPERTHERM Europe B.V.
IGUS
INE
ITW
LANSEC ITALIA
LINCOLN ELECTRIC ITALIA
LINK INDUSTRIES
MEDIAPOINT & COMMUNICATIONS
MEDIAVALUE
MESSER ITALIA
NDT ITALIANA
OLYMPUS ITALIA
ORBITALUM TOOLS
OUTOKUMPU
OXYTURBO
PUBLITEC
RANDSTAD GROUP ITALIA
REMASALD
RIVISTA MECCANICA & AUTOMAZIONE
RIVISTA TECN’È
RIVISTA U & C
RIVOIRA
SALDOBRAZ ENGINEERING SRL
SALTECO
SANDVIK ITALIA
SAPIO
SELCO
SE.MAT
SEMAT EQUIPMENT
SIAD
SIGMA INTERNATIONAL
SINCOSALD
SMART N.D.T.
TECNOELETTRA
TECNOMECCANICA
TELWIN
TQM
TRAFILERIE DI CITTADELLA
TRAFIMET DISTRIBUTION
VICTOR TECHNOLOGIES EUROPE
www.acaiacs.it
www.aectechnology.it
www.aipnd.it
www.airliquidewelding.it
www.anasta.it
www.anditaut.it
www.aqm.it
www.as-g.it
www.assomotoracing.it
www.bedra.com
www.bitcostruzioni.com
www.btw.it; www.bohlerweldinggroup.com
www.capilla-gmbh.de
www.ceaweld.com
www.cebora.it
www.cgm-cigiemme.it
www.watergas.it
www.commersald.com
www.drahtzug.de
www.delvigo.com
www.edibit.com
www.edimet.it; www.aluplanet.com
www.esab.it
www.esarc.it
www.oerlikon.it
www.eurocontrol.it
www.fbifbi.com
www.accadueo.com
www.affidabilita.eu
www.airet.it
www.fieramilano.it
www.bi-mec.it; www.ucimu.it
www.bimu-sfortec.com; www.ucimu.it
www.ucimu.it
www.messe-essen.de
www.euroblech.com
www.expolaser.it
www.centrofiera.it
www.lamiera.net; www.ucimu.it
www.monacofiere.com
www.mcmonline.it
www.senaf.it
www.metef.com
www.motorsportexpotech.it
www.samumetal.it
www.sea-tec.it
www.seponline.it
www.teknomotive.com
www.ttexpo.it
www.venmec.it
www.fav.it
www.airliquidewelding.it
www.ge.com
www.gilardoni.it
www.harms-wende.de
www.henkel.it
www.hypertherm.com
www.igus.it
www.ine.it
www.itw.com; www.millerwelds.com
www.lansec.it
www.lincolnelectric.it
www.linktrading.com
www.mediapointsrl.it
www.mediavalue.it
www.messeritalia.it
www.ndt.it
www.olympus.it
www.orbitalum.com
www.outokumpu.com
www.oxyturbo.it
www.publitec.it
www.randstad.it
www.remasald.it
www.mechanical-automation.com
www.tecnelab.it
www.mediavalue.it
www.rivoiragas.it
www.saldobraz.it
www.salteco.it
www.sandvik.com
www.grupposapio.it
www.selco.it
www.sematspa.it
www.sematequipment.com
www.siad.com
www.sigmainternational.it
www.sincosald.it
www.smartndt.it
www.tecnosa.it
www.tecnomeccanica.net
www.telwin.it
www.aicqcn.it
www.fileur.com
www.trafimetdistribution.com
www.victortechnologies.eu
Precision Hole Technology™
Taglio Plasma di fori
di altissima qualità
La realizzazione di fori di alta qualità con sistema plasma ha incontrato finora diverse
problematiche, soprattutto riguardo finitura dei bordi, perfetta circolarità e cilindricità.
Precision Hole Technology™, in abbinamento ai nuovi generatori da taglio ESAB m3 “G2”
plasma™, è una soluzione integrata di diversi parametri che operano insieme per realizzare fori
di alta qualità su acciai da 3 a 25 mm, con rapporto diametro foro/spessore lamiera 1 a 1.
I controlli numerici ESAB VISION™ 5x eseguono programmi di taglio con cicli di istruzioni
specifici, inclusa la compensazione del kerf (solco di taglio), condizione fondamentale per
ottenere precisione nella realizzazione di fori di piccolo diametro.
STRENGTH THROUGH COOPERATION
ESAB Saldatura SpA – Via Novara 57 / 59, 20010 Bareggio – MI – Tel. 02 979681 – [email protected] – www.esab.it
Scarica

Scarica la rivista in formato pdf - Istituto Italiano della Saldatura