Exploring Drug-Target interactions by MS-based proteomics Andrea Armirotti, Ph.D. Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 Part I Proteomics to elucidate the interaction mechanism Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 Palmitoylethanolamide a lipid messenger PEA exerts anti-inflammatory and anti-nociceptive effects in animal models by engaging the peroxisome proliferator-activated receptor-a (PPAR-a). X inhibition N-acylethanolamine-hydrolyzing acid amidase NAAA is a pharmacologically promising target for pain and inflammation Mazzari et al. Eur J Pharmacol. 1996 Calignano et al. Eur. J. Pharmacol. 2001 Lo Verme et al. Mol Pharmacol 2005 Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 NAAA Activation Lysosomes, pH 4.5 H2N Cys Active H2N Active NAAA SH Catalytic Residue O R1 b-Lactones as NAAA inhibitors O R2 Solorzano et al. PNAS 2009 Solorzano et al. J. Med. Chem. 2010 Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 COOH SPPAAPRFNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRG MCDFMNLSLADCLLVNLAYESSVFCTSIVAQDSRGHIYHGRNLDYPFGNVLRKLTVDVQFLKNGQIAFTGTTFI GYVGLWTGQSPHKFTVSGDERDKGWWWENAIAALFRRHIPVSWLIRATLSESENFEAAVGKLAKTPLIADVY YIVGGTSPREGVVITRNRDGPADIWPLDPLNGAWFRVETNYDHWKPAPKEDDRRTSAIKALNATGQANLSLEA LFQILSVVPVYNNFTIYTTVMSAGSPDKYMTRIRNPSRK 1) Cleaved in activation @ pH 4.5 2) Target Cysteine CTSIVAQDSRGHIYHGRNLDYPFGNVLRKLTVDVQFLKNGQIAFTGTTFIGYVGLWTGQSPHKFTVSGDERDK GWWWENAIAALFRRHIPVSWLIRATLSESENFEAAVGKLAKTPLIADVYYIVGGTSPREGVVITRNRDGPADIW PLDPLNGAWFRVETNYDHWKPAPKEDDRRTSAIKALNATGQANLSLEALFQILSVVPVYNNFTIYTTVMSAGS PDKYMTRIRNPSRK 3) Trypsin Digestion *CTSIVAQDSR New N-terminus peptide Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 A new, potent NAAA inhibitor ARN0077 IC50 (hNAAA) 7.3 nM Questions 1) Covalent or not? 2) Confirmation of the target residue (N term. Cys?) 3) Molecular Mechanism of action? Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 Experimental Details • • • Recombinant hNAAA purified from transfected HEK 293 cells Activation at pH 4.5, 37°C, followed by incubation with equimolar ARN0077 (90+90 min.) DDA (and MSe) acquisitions on Synapt G2 with nanoLC setup FL +077 Cont. 50 kDa 30 kDa Full Lenght Active hNAAA Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 RS D Q A V I S T C yMax 100 576.27 y5 262.15 y2 Native Peptide % 256.07 114.04 274.08 173.13 86.10 I 377.18 a4 y3 387.17 676.34 788.42 y7 577.28 505.24 y4 875.45 y8 +ARN0077 adduct 876.45 677.34 578.28 359.17 789.41 458.25 877.45 1026.50 1166.23 1221.77 1353.60 0 -0 100 200 R 300 S 400 D 500 Q 600 A 700 V 800 L 900 S 1000 T 1100 1200 C 1300 (291.14) M/z 1400 yMax 100 Native peptide ARN077 Dmass 576.28 y5 262.15 y2 Adduct 547.23 % 377.16 y3 274.15 74.06 147.12 T 676.35 788.44 875.47 y7 y8 577.29 444.22 678.33 578.28 343.17 679.33 789.44 876.47 790.45 877.47 976.52 y9 1027.53 1079.52 y10 1283.09 1326.77 0 -0 100 200 300 400 500 600 700 800 900 1000 1100 Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 1200 1300 M/z 1400 Inhibition Mechanism: 3 Possible Adducts Isomeric Species Not Observed Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 y2 Cys side chain fragmentations -H2O [ARN0077]+ -CO S-acylation diagnostic ion is overlapping y2 isotopic peak Result not conclusive Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 y2 ARN0768 Cys side chain fragmentations [ARN0768]+ -H2O -CO IC50 (hNAAA) 314 nM Active analog of ARN0077 At 20.000 resolution, S-acylation diagnostic ion is clearly detectable Conclusive Result Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 Inhibition mechanism of b-lactones on hNAAA 1) Covalent or not? Covalent 2) Confirmation of the target residue (N term. Cys) Yes 3) Molecular Mechanism of action? S-acylation References: Armirotti et al. ACS Med. Chem. Lett. 2012 Ponzano et al J. Med. Chem. In preparation Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 And what if the interaction is NOT covalent? (and you don’t know the target) Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 MCP 2012 The trick A non denaturing protein chromatography conservative toward D-T interactions • Incubation followed by cell lysis • Protein separation (IEX) and fraction collection • Drug followed by MRM Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 MRM Trace Drug Drug in cells Free drug Drug + Target IEX Chromatography Target ID Unboud drug Drug bound to target Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 Part II Drug-induced differences in expression profiles (test of Transomics platform) Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 Drug X inhibits Target Y DOWN regulates Protein P Expresses Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 MEF Cell Lines WT Group 1 Mutated Group 2 Group 3 Group 4 Drug (inhibitor of downregulator) Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 1) Cell Lysis 2) Protein Assay (10mg/group) I.S. Spiking (LYS_CHICK) different ratios for validation (8/10/2,5/3,3) Reduction, Alkylation Digestion HDMSe 1D nLC, 2Hrs gradient Triplicate injections (500ng on 75mmX25cm column) Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 HDMSe ToF MSe in the Transfer Precursors Fragments Same RT and drift time MSe using Look Up Tables Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 m/z Different slopes Different charge states Drift time With LUT, the applied CE is tailored on the precursor ion charge state Lys_Chick 8 10 2.5 3.3 Lys_Chick Spiking Ratio: 8-10-2,5-3,3 per group Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 Browsing through the Hits list... PCK2 Protein Mutated cells have a better response (unexpected result) Drug increases PCK2 expression Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 Drug X inhibits Target Y DOWN regulates Protein PCK2 Expresses Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 m/z PCK2 Peptide LGTPVLQALGDGDFIK 822,4507 m/z 66,8 min RT 6,55 ms DT RT LC-MS data maps Full visualization options for peak picking Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013 Ackowledgments Elisa Romeo Stefano Ponzano Benedetto Grimaldi Claudia De Mei Fabio Bertozzi Gianpiero Garau Glauco Tarozzo Tiziano Bandiera Istituto Italiano di Tecnologia, Drug Discovery and Development Department 2013